KEGG   Homo sapiens (human): 64184Help
Entry
64184             CDS       T01001                                 

Gene name
EDDM3B, EP3B, FAM12B, HE3-BETA, HE3B, RAM2
Definition
(RefSeq) epididymal protein 3B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 64184
NCBI-ProteinID: NP_071755
OMIM: 611582
HGNC: 19223
Ensembl: ENSG00000181552
Vega: OTTHUMG00000029583
Pharos: P56851(Tdark)
UniProt: P56851 W0UV31
Position
14q11.2
AA seq 147 aa AA seqDB search
MASSLKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEAL
KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF
NYIEFHCSMDGYVDSIEDLKMVEPIGN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtctctaaagatctggggcacactcttggccctactttgcatcctatgcaca
ctgcttgtacagagcaaagaagtttcttggagagaattcatgaaacagcactacttaagt
ccaagtcgagaattcagagagtacaaatgtgatgtcctcatgagagaaaatgaagctctg
aaagacaagagctctcacatgtttatctatatctcatggtacaaaatcgagcatatatgc
actagtgacaactggatggatcgcttccgaaatgcatatgtatgggtccagaatcctctc
aaagtactcaagtgtcaccaggagaattccaaaaatagctacacagagagcaggagcttc
aactacattgaattccattgtagcatggacgggtatgttgatagcatagaagacctaaag
atggtagaacctatcggcaactag

DBGET integrated database retrieval system