KEGG   Homo sapiens (human): 642Help
Entry
642               CDS       T01001                                 

Gene name
BLMH, BH, BMH
Definition
(RefSeq) bleomycin hydrolase
  KO
K01372  bleomycin hydrolase [EC:3.4.22.40]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    642 (BLMH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.40  bleomycin hydrolase
     642 (BLMH)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   642 (BLMH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1_2 Peptidase_C1
Motif
Other DBs
NCBI-GeneID: 642
NCBI-ProteinID: NP_000377
OMIM: 602403
HGNC: 1059
Ensembl: ENSG00000108578
Vega: OTTHUMG00000179756
Pharos: Q13867(Tbio)
UniProt: Q13867
Structure
PDB: 

Position
17q11.2
AA seq 455 aa AA seqDB search
MSSSGLNSEKVAALIQKLNSDPQFVLAQNVGTTHDLLDICLKRATVQRAQHVFQHAVPQE
GKPITNQKSSGRCWIFSCLNVMRLPFMKKLNIEEFEFSQSYLFFWDKVERCYFFLSAFVD
TAQRKEPEDGRLVQFLLMNPANDGGQWDMLVNIVEKYGVIPKKCFPESYTTEATRRMNDI
LNHKMREFCIRLRNLVHSGATKGEISATQDVMMEEIFRVVCICLGNPPETFTWEYRDKDK
NYQKIGPITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNKLYTVEYLSNMVGGRKTLY
NNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHELVFGVSLKNMNKA
ERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVY
EVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctcgggactgaattcggagaaggtagctgctctgatacagaaactgaattcc
gacccccagttcgtacttgcccagaatgtcgggaccacccacgacctgctggacatctgt
ctgaagcgggccacggtgcagcgcgcgcagcatgtgttccagcacgccgtgccccaggag
ggcaagccaatcaccaaccagaagagctcagggcgatgctggatcttttcttgtctgaat
gttatgaggcttccattcatgaaaaagttaaatattgaagaatttgagtttagccaatct
tacctgtttttttgggacaaggttgaacgctgttatttcttcttgagtgcttttgtggac
acagcccagagaaaggagcctgaggatgggaggctggtgcagtttttgcttatgaaccct
gcaaatgatggtggccaatgggatatgcttgttaatattgttgaaaaatatggtgttatc
cctaagaaatgcttccctgaatcttatacaacagaggcaaccagaaggatgaatgatatt
ctgaatcacaagatgagagaattctgtatacgactgcggaacctggtacacagtggagca
accaaaggagaaatctcggccacacaggacgtcatgatggaggagatattccgagtggtg
tgcatctgtttgggtaatccaccagagacattcacctgggaatatcgagacaaagataaa
aattatcagaaaattggccccataacacccttggagttttacagggaacatgtcaagcca
ctcttcaatatggaagataagatttgtttagtgaatgaccctaggccccagcacaagtac
aacaaactttacacagtggaatacttaagcaatatggttggagggagaaaaactctatac
aacaaccagcccattgacttcctgaaaaagatggttgctgcctccatcaaagatggagag
gctgtgtggtttggctgtgatgttggaaaacacttcaatagcaagctgggcctcagtgac
atgaatctctatgaccatgagttagtgtttggtgtctccttgaagaacatgaataaagcg
gagaggctgacttttggtgagtcacttatgacccacgccatgaccttcactgctgtctca
gagaaggatgatcaggatggtgctttcacaaaatggagagtggagaattcatggggtgaa
gaccatggccacaaaggttacctgtgcatgacagatgagtggttctctgagtatgtctac
gaagtggtggtggacaggaagcatgtccctgaagaggtgctagctgtgttagagcaggaa
cccattatcctgccagcatgggaccccatgggagctttggctgagtga

DBGET integrated database retrieval system