KEGG   Homo sapiens (human): 6421
Entry
6421              CDS       T01001                                 

Gene name
SFPQ, POMP100, PPP1R140, PSF
Definition
(RefSeq) splicing factor proline and glutamine rich
  KO
K13219  splicing factor, proline- and glutamine-rich
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    6421 (SFPQ)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6421 (SFPQ)
   03041 Spliceosome [BR:hsa03041]
    6421 (SFPQ)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6421 (SFPQ)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     6421 (SFPQ)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    6421 (SFPQ)
SSDB
Motif
Pfam: RRM_1 NOPS RRM_7
Other DBs
NCBI-GeneID: 6421
NCBI-ProteinID: NP_005057
OMIM: 605199
HGNC: 10774
Ensembl: ENSG00000116560
Vega: OTTHUMG00000004157
Pharos: P23246(Tbio)
UniProt: P23246 A0A384N5Z8 Q86VG2
Structure
PDB: 
6NCQ 4WII 5WPA 4WIK 4WIJ

Position
1p34.3
AA seq 707 aa
MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPI
PPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPG
VGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQ
AGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
PRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF
VGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGR
QLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS
KPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRF
AQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLM
RRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRM
GYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGS
DMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgtctcgggatcggttccggagtcgtggcggtggcggtggtggcttccacaggcgtgga
ggaggcggcggccgcggcggcctccacgacttccgttctccgccgcccggcatgggcctc
aatcagaatcgcggccccatgggtcctggcccgggccagagcggccctaagcctccgatc
ccgccaccgcctccacaccaacagcagcaacagccaccaccgcagcagccaccgccgcag
cagccgccaccgcatcagccgccgccgcatccacagccgcatcagcagcagcagccgccg
ccaccgccgcaggactcttccaagcccgtcgttgctcagggacccggccccgctcccgga
gtaggcagcgcaccaccagcctccagctcggccccgcccgccactccaccaacctcgggg
gccccgccagggtccgggccaggcccgactccgaccccgccgcctgcagtcacctcggcc
cctcccggggcgccgccacccaccccgccaagcagcggggtccctaccacacctcctcag
gccggaggcccgccgcctccgcccgcggcagtcccgggcccgggtccagggcctaagcag
ggcccaggtccgggtggtcccaaaggcggcaaaatgcctggcgggccgaagccaggtggc
ggcccgggcctaagtacgcctggcggccaccccaagccgccgcatcgaggcggcggggag
ccccgcgggggccgccagcaccacccgccctaccaccagcagcatcaccaggggcccccg
cccggcgggcccggcggccgcagcgaggagaagatctcggactcggaggggtttaaagcc
aatttgtctctcttgaggaggcctggagagaaaacttacacacagcgatgtcggttgttt
gttgggaatctacctgctgatatcacggaggatgaattcaaaagactatttgctaaatat
ggagaaccaggagaagtttttatcaacaaaggcaaaggattcggatttattaagcttgaa
tctagagctttggctgaaattgccaaagccgaactggatgatacacccatgagaggtaga
cagcttcgagttcgctttgccacacatgctgctgccctttctgttcgtaatctttcacct
tatgtttccaatgaactgttggaagaagcctttagccaatttggtcctattgaaagggct
gttgtaatagtggatgatcgtggaagatctacagggaaaggcattgttgaatttgcttct
aagccagcagcaagaaaggcatttgaacgatgcagtgaaggtgttttcttactgacgaca
actcctcgtccagtcattgtggaaccacttgaacaactagatgatgaagatggtcttcct
gaaaaacttgcccagaagaatccaatgtatcaaaaggagagagaaacccctcctcgtttt
gcccagcatggcacgtttgagtacgaatattctcagcgatggaagtctttggatgaaatg
gaaaaacagcaaagggaacaagttgaaaaaaacatgaaagatgcaaaagacaaattggaa
agtgaaatggaagatgcctatcatgaacatcaggcaaatcttttgcgccaagatctgatg
agacgacaggaagaattaagacgcatggaagaacttcacaatcaagaaatgcagaaacgt
aaagaaatgcaattgaggcaagaggaggaacgacgtagaagagaggaagagatgatgatt
cgtcaacgtgagatggaagaacaaatgaggcgccaaagagaggaaagttacagccgaatg
ggctacatggatccacgggaaagagacatgcgaatgggtggcggaggagcaatgaacatg
ggagatccctatggttcaggaggccagaaatttccacctctaggaggtggtggtggcata
ggttatgaagctaatcctggcgttccaccagcaaccatgagtggttccatgatgggaagt
gacatgcgtactgagcgctttgggcagggaggtgcggggcctgtgggtggacagggtcct
agaggaatggggcctggaactccagcaggatatggtagagggagagaagagtacgaaggc
ccaaacaaaaaaccccgattttag

DBGET integrated database retrieval system