KEGG   Homo sapiens (human): 64216Help
Entry
64216             CDS       T01001                                 

Gene name
TFB2M, Hkp1, mtTFB2
Definition
(RefSeq) transcription factor B2, mitochondrial
  KO
K17653  dimethyladenosine transferase 2, mitochondrial [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    64216 (TFB2M)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     64216 (TFB2M)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial transcription factors
    64216 (TFB2M)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RrnaAD HTH_9 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 64216
NCBI-ProteinID: NP_071761
OMIM: 607055
HGNC: 18559
Ensembl: ENSG00000162851
Vega: OTTHUMG00000040091
Pharos: Q9H5Q4(Tbio)
UniProt: Q9H5Q4
Structure
PDB: 

Position
1q44
AA seq 396 aa AA seqDB search
MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNP
PRKASKASLDFKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKV
VALESDKTFIPHLESLGKNLDGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEA
VPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMAD
PGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQKLYLIQ
MIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDE
KVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcccagtggtcgggcttcctcggcggctgaggctctccgccttggcgggcgct
ggtcgcttttgcattttagggtctgaagcggcgacgcgaaagcatttgccggcgaggaac
cactgtgggctctctgactcctctccgcagctgtggcccgaaccggatttcaggaatccg
ccaaggaaggcgtctaaggccagcttagactttaagcgttacgtaaccgatcggagattg
gctgagaccctggcgcaaatctatttgggaaaaccaagtagacctccacacctactgctg
gagtgcaatccaggtcctggaatcctgactcaggcattacttgaagctggtgccaaagtg
gttgcgctcgaaagtgacaaaacttttattccacatttggagtccttaggaaaaaatctg
gatggaaaactacgagtgattcactgtgacttctttaaactagatcctagaagtggtgga
gtaataaaaccacctgctatgtcttctcgagggctctttaagaatttgggaatagaagca
gttccttggacagcagacatccctttaaaagtagttggaatgttcccaagtagaggtgag
aaaagggcactttggaaactcgcatatgacttgtattcctgtacttctatatataaattt
ggacgaatagaagtaaatatgtttattggtgaaaaagaattccagaaactaatggcagat
cccggaaatccagacttgtatcatgtattaagtgttatctggcaattagcttgtgagatt
aaggttctgcacatggagccttggtcatcatttgatatatacacccggaaagggccgctg
gaaaacccaaagcgtagggaattattagaccaattacaacaaaagctgtatcttattcaa
atgattcctcgtcaaaatttatttaccaagaacttaacacctatgaactataatatattt
tttcacttgttaaagcactgttttgggaggcgcagcgccactgtaatagaccacttacgt
tcattgactccacttgatgcgagagatatattgatgcaaataggaaaacaggaggatgag
aaagtagttaacatgcaccctcaagacttcaaaacactttttgaaactatagagcgttcc
aaagattgtgcttataaatggctgtatgatgaaaccctggaagataggtag

DBGET integrated database retrieval system