KEGG   Homo sapiens (human): 64219
Entry
64219             CDS       T01001                                 
Symbol
PJA1, PRAJA1, RNF70
Name
(RefSeq) praja ring finger ubiquitin ligase 1
  KO
K10633  E3 ubiquitin-protein ligase Praja1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    64219 (PJA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     64219 (PJA1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    64219 (PJA1)
SSDB
Motif
Pfam: zf-RING_2 zf-C3HC4 zf-rbx1 zf-C3HC4_2 zf-RING_11 zf-RING_UBOX zf-RING_5 zf-ANAPC11 zf-C3HC4_3 zf-RING_16
Other DBs
NCBI-GeneID: 64219
NCBI-ProteinID: NP_660095
OMIM: 300420
HGNC: 16648
Ensembl: ENSG00000181191
Vega: OTTHUMG00000021753
Pharos: Q8NG27(Tbio)
UniProt: Q8NG27
Structure
Position
X:complement(69160746..69165453)
AA seq 643 aa
MGQESSKPVWPNPTGGYQSNTGRRYGRRHAYVSFRPPTSQRERIASQRKTNSEVPMHRSA
PSQTTKRSRSPFSTTRRSWDDSESSGTNLNIDNEDYSRYPPREYRASGSRRGMAYGHIDS
YGADDSEEEGAGPVERPPVRGKTGKFKDDKLYDPEKGARSLAGPPPHFSSFSRDVREERD
KLDPVPAARCSASRADFLPQSSVASQSSSEGKLATKGDSSERERREQNLPARPSRAPVSI
CGGGENTSKSAEEPVVRPKIRNLASPNCVKPKIFFDTDDDDDMPHSTSRWRDTANDNEGH
SDGLARRGRGESSSGYPEPKYPEDKREARSDQVKPEKVPRRRRTMADPDFWTHSDDYYKY
CDEDSDSDKEWIAALRRKYRSREQTLSSSGESWETLPGKEEREPPQAKVSASTGTSPGPG
ASASAGAGAGASAGSNGSNYLEEVREPSLQEEQASLEEGEIPWLQYHENDSSSEGDNDSG
HELMQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMAL
EERLAQAMETALAHLESLAVDVEVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCS
EYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgggtcaggaatctagcaagcctgtatggcccaatccaacaggagggtatcagtccaat
acaggtaggaggtatggaagaaggcatgcttatgtcagtttcaggccacccacgagccag
cgggaaaggattgccagccagagaaagacgaactccgaagtcccaatgcacagatcagcc
cccagtcaaaccaccaagaggagccgatcgccattttccactactcgtcgtagttgggac
gacagcgagagttcgggaaccaacctgaatattgataatgaggactattccaggtatccg
ccaagagagtacagagcttcgggtagcagaagaggaatggcctatggacatattgactct
tatggggcagatgatagtgaggaggagggggctgggcctgttgagcgaccgccagtgaga
gggaaaactggcaagtttaaagatgataagctgtatgacccagagaaaggggcaaggtct
ttggctgggccacctccacatttctctagttttagccgtgatgtgagagaggagcgagac
aagttagacccagtccctgcagcaagatgctcagctagcagagctgacttcctgccacaa
agtagtgtggcctcacagtcgtcttctgaaggcaagctggctacaaaaggtgacagctcg
gagagggagagaagggagcaaaatttacctgcacgtcccagcagggctcctgtgagtatt
tgtggtggtggggaaaacacctcaaagagtgcagaggaacctgtggtcaggcccaaaatc
agaaacctggcaagtccaaactgcgtgaaaccaaaaattttttttgatactgatgatgat
gacgatatgccacacagtacttccaggtggagggataccgccaatgacaatgagggccac
tcggatggcctggcaagaagagggagaggcgagagttcaagtggctatcccgagccaaag
taccctgaagacaaacgggaagcgaggagtgaccaagtgaaaccagaaaaggtgccgaga
cgacgacgcaccatggccgaccctgacttctggacgcacagtgatgattactacaaatac
tgcgacgaagactctgacagtgacaaagagtggattgctgctctgcgtcggaaatatcga
agccgagagcaaaccctgtcctccagtggcgaaagctgggagactctgccggggaaagaa
gagcgggaacctccacaggctaaggtgagtgccagcactggcaccagccctggccccggt
gctagtgccagtgccggggctggcgccggggccagtgctggcagcaatggcagcaattac
cttgaagaagttcgagaaccatctcttcaggaagagcaggcatccctggaagaaggagaa
attccttggctccagtaccatgagaatgacagtagcagtgagggggataatgattctggt
cacgagttgatgcaacctggggtattcatgctggatggaaacaacaaccttgaagatgac
tccagtgtgagcgaagacctagaagtggattggagcctctttgatggatttgcagatggg
ttaggagtggctgaagccatttcctatgtggaccctcagttcctcacctacatggcactt
gaagaacgcctggcccaggcaatggaaactgcccttgcgcacttggagtctctcgcagtg
gatgtagaggtggccaatccaccagcaagcaaggagagcattgacgctcttcccgagatc
ctggtcactgaagatcatggcgcagttggtcaggagatgtgctgccccatctgctgtagc
gaatatgtgaagggggaggtggcaactgagctgccgtgccaccactatttccacaagccg
tgtgtgtccatctggcttcagaagtcaggcacctgccccgtgtgccgctgcatgttccct
cccccactctaa

DBGET integrated database retrieval system