KEGG   Homo sapiens (human): 6422Help
Entry
6422              CDS       T01001                                 

Gene name
SFRP1, FRP, FRP-1, FRP1, FrzA, SARP2
Definition
(RefSeq) secreted frizzled related protein 1
  KO
K02166  secreted frizzled-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6422 (SFRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR DUF555
Motif
Other DBs
NCBI-GeneID: 6422
NCBI-ProteinID: NP_003003
OMIM: 604156
HGNC: 10776
Ensembl: ENSG00000104332
Vega: OTTHUMG00000164074
Pharos: Q8N474(Tchem)
UniProt: Q8N474
Position
8p11.21
AA seq 314 aa AA seqDB search
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgggcgcagcgaggggggccgccgcggggcagccctgggcgtgctgctggcg
ctgggcgcggcgcttctggccgtgggctcggccagcgagtacgactacgtgagcttccag
tcggacatcggcccgtaccagagcgggcgcttctacaccaagccacctcagtgcgtggac
atccccgcggacctgcggctgtgccacaacgtgggctacaagaagatggtgctgcccaac
ctgctggagcacgagaccatggcggaggtgaagcagcaggccagcagctgggtgcccctg
ctcaacaagaactgccacgccggcacccaggtcttcctctgctcgctcttcgcgcccgtc
tgcctggaccggcccatctacccgtgtcgctggctctgcgaggccgtgcgcgactcgtgc
gagccggtcatgcagttcttcggcttctactggcccgagatgcttaagtgtgacaagttc
cccgagggggacgtctgcatcgccatgacgccgcccaatgccaccgaagcctccaagccc
caaggcacaacggtgtgtcctccctgtgacaacgagttgaaatctgaggccatcattgaa
catctctgtgccagcgagtttgcactgaggatgaaaataaaagaagtgaaaaaagaaaat
ggcgacaagaagattgtccccaagaagaagaagcccctgaagttggggcccatcaagaag
aaggacctgaagaagcttgtgctgtacctgaagaatggggctgactgtccctgccaccag
ctggacaacctcagccaccacttcctcatcatgggccgcaaggtgaagagccagtacttg
ctgacggccatccacaagtgggacaagaaaaacaaggagttcaaaaacttcatgaagaaa
atgaaaaaccatgagtgccccacctttcagtccgtgtttaagtga

DBGET integrated database retrieval system