KEGG   Homo sapiens (human): 6423
Entry
6423              CDS       T01001                                 

Symbol
SFRP2, FRP-2, SARP1, SDF-5
Name
(RefSeq) secreted frizzled related protein 2
  KO
K02176  secreted frizzled-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6423 (SFRP2)
SSDB
Motif
Pfam: Fz NTR
Other DBs
NCBI-GeneID: 6423
NCBI-ProteinID: NP_003004
OMIM: 604157
HGNC: 10777
Ensembl: ENSG00000145423
Vega: OTTHUMG00000161559
Pharos: Q96HF1(Tbio)
UniProt: Q96HF1 A0A140VJU3 B3KSM5
Position
4:complement(153780591..153789083)
AA seq 295 aa
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
NT seq 888 nt   +upstreamnt  +downstreamnt
atgctgcagggccctggctcgctgctgctgctcttcctcgcctcgcactgctgcctgggc
tcggcgcgcgggctcttcctctttggccagcccgacttctcctacaagcgcagcaattgc
aagcccatccctgccaacctgcagctgtgccacggcatcgaataccagaacatgcggctg
cccaacctgctgggccacgagaccatgaaggaggtgctggagcaggccggcgcttggatc
ccgctggtcatgaagcagtgccacccggacaccaagaagttcctgtgctcgctcttcgcc
cccgtctgcctcgatgacctagacgagaccatccagccatgccactcgctctgcgtgcag
gtgaaggaccgctgcgccccggtcatgtccgccttcggcttcccctggcccgacatgctt
gagtgcgaccgtttcccccaggacaacgacctttgcatccccctcgctagcagcgaccac
ctcctgccagccaccgaggaagctccaaaggtatgtgaagcctgcaaaaataaaaatgat
gatgacaacgacataatggaaacgctttgtaaaaatgattttgcactgaaaataaaagtg
aaggagataacctacatcaaccgagataccaaaatcatcctggagaccaagagcaagacc
atttacaagctgaacggtgtgtccgaaagggacctgaagaaatcggtgctgtggctcaaa
gacagcttgcagtgcacctgtgaggagatgaacgacatcaacgcgccctatctggtcatg
ggacagaaacagggtggggagctggtgatcacctcggtgaagcggtggcagaaggggcag
agagagttcaagcgcatctcccgcagcatccgcaagctgcagtgctag

DBGET integrated database retrieval system