KEGG   Homo sapiens (human): 64236Help
Entry
64236             CDS       T01001                                 

Gene name
PDLIM2, MYSTIQUE, SLIM
Definition
(RefSeq) PDZ and LIM domain 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ DUF4749 PDZ_6 LIM PDZ_2
Motif
Other DBs
NCBI-GeneID: 64236
NCBI-ProteinID: NP_789847
OMIM: 609722
HGNC: 13992
Ensembl: ENSG00000120913
Vega: OTTHUMG00000164270
Pharos: Q96JY6(Tbio)
UniProt: Q96JY6
Structure
PDB: 

Position
8p21.3
AA seq 366 aa AA seqDB search
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRS
SYSSPTSLSPRAGSPFSPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ
AGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
SFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI
QEGRYRHPGCYTCADCGLNLKMRGHFWEDACAMEGMRLSLEALEGMVEGAKRRDRRKTRR
PIQPSW
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgacggtggatgtggccgggccagcgccctggggcttccgtatcacagggggc
agggatttccacacgcccatcatggtgactaaggtggccgagcggggcaaagccaaggac
gctgacctccggcctggagacataatcgtggccatcaacggggaaagcgcggagggcatg
ctgcatgccgaggcccagagcaagatccgccagagcccctcgcccctgcggctgcagctg
gaccggtctcaggctacgtctccagggcagaccaatggggacagctccttggaagtgctg
gcgactcgcttccagggctccgtgaggacatacactgagagtcagtcctccttaaggtcc
tcctactccagcccaacctccctcagcccgagggccggcagccccttctcaccaccaccc
tctagcagctccctcactggagaggcagccatcagccgcagcttccagagtctggcatgt
tccccgggcctccccgctgctgaccgcctgtcctactcaggccgccctggaagccgacag
gccggcctcggccgcgctggcgactcggcggtgctggtgctgccgccttccccgggccct
cgttcctccaggcccagcatggactcggaagggggaagcctcctcctggacgaggactcg
gaagtcttcaagatgctgcaggaaaatcgcgagggacgggcggccccccgacagtccagc
tcctttcggctcttgcaggaagccctggaggctgaggagagaggtggcacgccagccttc
ttgcccagctcactgagcccccagtcctccctgcccgcctccagggccctggccacccct
cccaagctccacacttgtgagaagtgcagtaccagcatcgcgaaccaggctgtgcgcatc
caggagggccggtaccgccaccccggctgctacacctgtgccgactgtgggctgaacctg
aagatgcgcgggcacttctgggaggacgcttgtgctatggagggaatgagattgtcactg
gaagctttggaggggatggtggagggcgccaagcggagggacaggaggaagaccaggaga
cccatccagccaagctggtga

DBGET integrated database retrieval system