KEGG   Homo sapiens (human): 642475Help
Entry
642475            CDS       T01001                                 

Gene name
MROH6, C8orf73
Definition
(RefSeq) maestro heat like repeat family member 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 642475
NCBI-ProteinID: NP_001094348
HGNC: 27814
Ensembl: ENSG00000204839
Vega: OTTHUMG00000165164
Pharos: A6NGR9(Tdark)
UniProt: A6NGR9
Position
8q24.3
AA seq 719 aa AA seqDB search
MAGGVWGRSRAREAPVGALTLTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQA
LTAPSEAEPGRGATVPEAGSEPCSLNSALEPAPEGPHQVPQSSWEEGVLADLALYTAACL
EEAGFAGTQATVLTLSSALEARGERLEDQVHALVRGLLAQVPSLAEGRPWRAALRVLSAL
ALEHARDVVCALLPRSLPADRVAAELWRSLSRNQRVNGQVLVQLLWALKGASGPEPQALA
ATRALGEMLAVSGCVGATRGFYPHLLLALVTQLHKLARSPCSPDMPKIWVLSHRGPPHSH
ASCAVEALKALLTGDGGRMVVTCMEQAGGWRRLVGAHTHLEGVLLLASAMVAHADHHLRG
LFADLLPRLRSADDPQRLTAMAFFTGLLQSRPTARLLREEVILERLLTWQGDPEPTVRWL
GLLGLGHLALNRRKVRHVSTLLPALLGALGEGDARLVGAALGALRRLLLRPRAPVRLLSA
ELGPRLPPLLDDTRDSIRASAVGLLGTLVRRGRGGLRLGLRGPLRKLVLQSLVPLLLRLH
DPSRDAAESSEWTLARCDHAFCWGLLEELVTVAHYDSPEALSHLCCRLVQRYPGHVPNFL
SQTQGYLRSPQDPLRRAAAVLIGFLVHHASPGCVNQDLLDSLFQDLGRLQSDPKPAVAAA
AHVSAQQVAMLARARGCPRGPRLLRIAPRPARPPPVFADSPFQRRSVAGRWGCSGPRRA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggctgggggtgtgtggggccggagccgggcccgggaggctcccgtgggggctctaacc
ctgacagcactgactgaaggaatccgggccaggcaggggcagccccagggacccccttcc
gcaggccctcagcccaagtcctgggaggtcaaacctgaggctgagccacagacccaggca
ctcaccgccccctctgaggcagagcctggacgtggggccaccgtccctgaagctggcagc
gagccctgctccctcaacagtgccctggaaccagcccctgaggggccccaccaggttccc
cagagttcctgggaggagggagttcttgccgacctcgcgttgtacacggctgcctgcctg
gaggaggctggctttgcagggacccaggcgacagtgctcaccctgtcctcagccctggag
gcccggggcgagcggttggaggaccaggtgcatgctctggtgcgtgggctgctggcgcag
gtgcccagcctagcggaggggaggccctggagggcggccctgcgagtgctgagcgcactg
gccctggagcatgcgcgggacgtggtgtgtgcgctgctaccccgctctctgcccgccgat
cgggtagcagccgagctctggcgcagcctaagccgtaaccagcgtgtaaatgggcaggtg
ctggtgcaactgctgtgggcgctgaagggtgcttcggggccggagccccaggcactggcg
gccacacgtgctcttggggagatgctggctgtttcgggctgcgtgggagccacgaggggc
ttctacccacatctgctgcttgcgctggtcacacagctgcacaagctggcccgcagcccg
tgctcccccgacatgcccaagatttgggttctgtcccaccgagggccaccacatagccat
gccagctgtgctgtggaggccttgaaggcgctgctcaccggggatggaggccgcatggtg
gtcacgtgcatggagcaggcaggaggctggaggaggctggtgggagcccacacccacctg
gagggcgtcctgctgctggccagtgctatggtggcacatgccgaccaccacctgcgaggc
ctcttcgcagacttgctccctcggcttcgcagcgcggacgacccgcagcgtctcacggct
atggccttcttcacagggctgttgcagagccggcccaccgcacggctcctgcgggaggag
gtcatcctggagcgactcctcacctggcagggagaccccgaacccactgtgcgctggttg
ggcctgctgggcctgggccacctcgcgctgaatcgcaggaaggtgcggcacgtgagcacg
ctgctgccggcgctcctgggcgcactgggcgaaggcgacgcgcggctcgtgggtgcagcg
ctgggcgccctgaggaggctcctgctgcggccccgggcgcctgtgcggctcctgagcgcg
gagctgggaccgcgcctccctccgctactggacgacacacgggactcaatccgcgcctcg
gccgtcgggctccttgggactctggtgcgccggggccggggcgggctccggctggggctc
cgcggccccctgcggaagctggtgctgcagagtctcgtgccgctgctgctgcgcctgcat
gaccccagcagggacgctgctgagagctcagagtggaccctggcccgctgtgaccacgcc
ttttgctggggcctgctggaggagttggtcaccgtggcccactatgacagccccgaggcc
ctgagccacctctgctgccgcctggttcagcgatacccaggccacgtgcccaacttcctg
agccagacccagggctacctgcggagtccacaggaccccctgcgccgggcagccgccgtg
cttataggcttccttgtccaccacgccagccccggctgtgtcaaccaggacctgctggac
tccctgttccaggacctagggcgactgcagagcgaccccaagccggctgtggccgcggca
gcgcacgtgtccgctcagcaggtggcgatgctggcccgtgcccggggctgcccccgcggg
ccccgccttctccgcatcgccccgcgccccgcccggcccccaccagtcttcgccgacagc
cccttccagcgccggagcgtcgcgggccgctggggctgctccggaccccgccgagcctga

DBGET integrated database retrieval system