KEGG   Homo sapiens (human): 6425
Entry
6425              CDS       T01001                                 
Symbol
SFRP5, SARP3
Name
(RefSeq) secreted frizzled related protein 5
  KO
K02222  secreted frizzled-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6425 (SFRP5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6425 (SFRP5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I93
   6425 (SFRP5)
SSDB
Motif
Pfam: Fz NTR
Other DBs
NCBI-GeneID: 6425
NCBI-ProteinID: NP_003006
OMIM: 604158
HGNC: 10779
Ensembl: ENSG00000120057
Pharos: Q5T4F7(Tbio)
UniProt: Q5T4F7
Position
10:complement(97766751..97771999)
AA seq 317 aa
MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADL
PLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRP
IYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKI
CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDT
KRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
YPCSLYYPFFYGAAEPH
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcgggcggcggcggcgggggggggcgtgcggacggccgcgctggcgctgctgctgggg
gcgctgcactgggcgccggcgcgctgcgaggagtacgactactatggctggcaggccgag
ccgctgcacggccgctcctactccaagccgccgcagtgccttgacatccctgccgacctg
ccgctctgccacacggtgggctacaagcgcatgcggctgcccaacctgctggagcacgag
agcctggccgaagtgaagcagcaggcgagcagctggctgccgctgctggccaagcgctgc
cactcggatacgcaggtcttcctgtgctcgctctttgcgcccgtctgtctcgaccggccc
atctacccgtgccgctcgctgtgcgaggccgtgcgcgccggctgcgcgccgctcatggag
gcctacggcttcccctggcctgagatgctgcactgccacaagttccccctggacaacgac
ctctgcatcgccgtgcagttcgggcacctgcccgccaccgcgcctccagtgaccaagatc
tgcgcccagtgtgagatggagcacagtgctgacggcctcatggagcagatgtgctccagt
gactttgtggtcaaaatgcgcatcaaggagatcaagatagagaatggggaccggaagctg
attggagcccagaaaaagaagaagctgctcaagccgggccccctgaagcgcaaggacacc
aagcggctggtgctgcacatgaagaatggcgcgggctgcccctgcccacagctggacagc
ctggcgggcagcttcctggtcatgggccgcaaagtggatggacagctgctgctcatggcc
gtctaccgctgggacaagaagaataaggagatgaagtttgcagtcaaattcatgttctcc
tacccctgctccctctactaccctttcttctacggggcggcagagccccactga

DBGET integrated database retrieval system