KEGG   Homo sapiens (human): 6428
Entry
6428              CDS       T01001                                 

Gene name
SRSF3, SFRS3, SRp20
Definition
(RefSeq) serine and arginine rich splicing factor 3
  KO
K12892  splicing factor, arginine/serine-rich 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6428 (SRSF3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6428 (SRSF3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6428 (SRSF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6428 (SRSF3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6428 (SRSF3)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded
Other DBs
NCBI-GeneID: 6428
NCBI-ProteinID: NP_003008
OMIM: 603364
HGNC: 10785
Ensembl: ENSG00000112081
Vega: OTTHUMG00000014599
Pharos: P84103(Tbio)
UniProt: P84103 B2R6F3
Structure
PDB: 
2I38

Position
6p21.31-p21.2
AA seq 164 aa
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcatcgtgattcctgtccattggactgtaaggtttatgtaggcaatcttggaaacaat
ggcaacaagacggaattggaacgggcttttggctactatggaccactccgaagtgtgtgg
gttgctagaaacccacccggctttgcttttgttgaatttgaagatccccgagatgcagct
gatgcagtccgagagctagatggaagaacactatgtggctgccgtgtaagagtggaactg
tcgaatggtgaaaaaagaagtagaaatcgtggcccacctccctcttggggtcgtcgccct
cgagatgattatcgtaggaggagtcctccacctcgtcgcagatctccaagaaggagaagc
ttctctcgcagccggagcaggtccctttctagagataggagaagagagagatcgctgtct
cgggagagaaatcacaagccgtcccgatccttctctaggtctcgtagtcgatctaggtca
aatgaaaggaaatag

DBGET integrated database retrieval system