KEGG   Homo sapiens (human): 643Help
Entry
643               CDS       T01001                                 

Gene name
CXCR5, BLR1, CD185, MDR15
Definition
(RefSeq) C-X-C motif chemokine receptor 5
  KO
K04190  C-X-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    643 (CXCR5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    643 (CXCR5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CXC Chemokine
    643 (CXCR5)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   643 (CXCR5)
CD molecules [BR:hsa04090]
 Proteins
  643 (CXCR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 DUF4059
Motif
Other DBs
NCBI-GeneID: 643
NCBI-ProteinID: NP_001707
OMIM: 601613
HGNC: 1060
Ensembl: ENSG00000160683
Vega: OTTHUMG00000166345
Pharos: P32302(Tbio)
UniProt: P32302 A0N0R2 A8K647 Q2YD84
Position
11q23.3
AA seq 372 aa AA seqDB search
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSL
IFLLGVIGNVLVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTF
LCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLL
ALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHVAGFLLPMLVMGWCYVG
VVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL
PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSL
SESENATSLTTF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaactacccgctaacgctggaaatggacctcgagaacctggaggacctgttctgggaa
ctggacagattggacaactataacgacacctccctggtggaaaatcatctctgccctgcc
acagaggggcccctcatggcctccttcaaggccgtgttcgtgcccgtggcctacagcctc
atcttcctcctgggcgtgatcggcaacgtcctggtgctggtgatcctggagcggcaccgg
cagacacgcagttccacggagaccttcctgttccacctggccgtggccgacctcctgctg
gtcttcatcttgccctttgccgtggccgagggctctgtgggctgggtcctggggaccttc
ctctgcaaaactgtgattgccctgcacaaagtcaacttctactgcagcagcctgctcctg
gcctgcatcgccgtggaccgctacctggccattgtccacgccgtccatgcctaccgccac
cgccgcctcctctccatccacatcacctgtgggaccatctggctggtgggcttcctcctt
gccttgccagagattctcttcgccaaagtcagccaaggccatcacaacaactccctgcca
cgttgcaccttctcccaagagaaccaagcagaaacgcatgcctggttcacctcccgattc
ctctaccatgtggcgggattcctgctgcccatgctggtgatgggctggtgctacgtgggg
gtagtgcacaggttgcgccaggcccagcggcgccctcagcggcagaaggcagtcagggtg
gccatcctggtgacaagcatcttcttcctctgctggtcaccctaccacatcgtcatcttc
ctggacaccctggcgaggctgaaggccgtggacaatacctgcaagctgaatggctctctc
cccgtggccatcaccatgtgtgagttcctgggcctggcccactgctgcctcaaccccatg
ctctacactttcgccggcgtgaagttccgcagtgacctgtcgcggctcctgacgaagctg
ggctgtaccggccctgcctccctgtgccagctcttccctagctggcgcaggagcagtctc
tctgagtcagagaatgccacctctctcaccacgttctag

DBGET integrated database retrieval system