KEGG   Homo sapiens (human): 64318
Entry
64318             CDS       T01001                                 
Symbol
NOC3L, AD24, C10orf117, FAD24
Name
(RefSeq) NOC3 like DNA replication regulator
  KO
K14834  nucleolar complex protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    64318 (NOC3L)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    64318 (NOC3L)
SSDB
Motif
Pfam: CBF NOC3p DUF6242 DsrD
Other DBs
NCBI-GeneID: 64318
NCBI-ProteinID: NP_071896
OMIM: 610769
HGNC: 24034
Ensembl: ENSG00000173145
UniProt: Q8WTT2
Position
10:complement(94314907..94362939)
AA seq 800 aa
MKARRNKKQIPSFRKLIKTSKVKLENKLKNKQFKQQSTLKKYRKEQRKLRQAVKDAVSKK
PIPLENPKEKRPGKRIEREEEEEEEALPLDMMDEDDLQLMKDLGQRVSFLTRDLSSSEPV
HAKKRKHERIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPVTDSNKDEEDQ
EEERELEEEIIEDPIQELTIEEHLIERKKKLQEKKMHIAALASAILSDPENNIKKLKELR
SMLMEQDPDVAVTVRKLVIVSLMELFKDITPSYKIRPLTEAEKSTKTRKETQKLREFEEG
LVSQYKFYLENLEQMVKDWKQRKLKKSNVVSLKAYKGLAEVAVKSLCELLVALPHFNFHN
NIIVLIVPLMNDMSKLISEMCCEAVKKLFKQDKLGQASLGVIKVISGFVKGRNYEVRPEM
LKTFLCLRIKEVEVKKDTEDINKPKKFMTFKEKRKSLSRMQRKWKKAEEKLERELREAEA
SESTEKKLKLHTETLNIVFVTYFRILKKAQRSPLLPAVLEGLAKFAHLINVEFFDDLLVV
LHTLIESGDLSYQESLHCVQTAFHILSGQGDVLNIDPLKFYTHLYKTLFKLHAGATNEGV
EIVLQCLDVMLTKRRKQVSQQRALAFIKRLCTLALHVLPNSSIGILATTRILMHTFPKTD
LLLDSESQGSGVFLPELDEPEYCNAQNTALWELHALRRHYHPIVQRFAAHLIAGAPSEGS
GALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYS
SEVATESPLDFTKYLKTSLH
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgaaggcgagaagaaataaaaaacagatcccaagctttcgcaagttaataaaaactagt
aaagtcaaacttgaaaacaagctaaaaaataagcagtttaaacaacaaagcactctcaag
aagtaccgaaaagaacagaggaaactaaggcaagctgtgaaagatgctgtgtctaagaaa
cccattccattggagaacccaaaggaaaagcgaccaggtaaaaggattgagagggaagaa
gaggaagaagaagaagcccttcctttagatatgatggatgaagatgacttacagttaatg
aaggatttaggacaaagagtatcttttctaacaagagatctttcttctagtgagcctgtt
catgcgaagaaacggaagcatgaacgcattatagataaatatgaaaaaataccaagaact
ctgcaaactgcaccagagaaggaactgattcatttacttcctatcaaagataaaagtggt
ataatcccacagactagggagaagccagttactgatagtaacaaagatgaagaggatcaa
gaagaagagagggaacttgaggaagagatcattgaagatcctattcaagagctgaccata
gaagaacatttgattgagagaaagaagaaattacaggagaagaagatgcatattgcagcc
ttggcatctgccatattatcagatccagaaaataatattaaaaaattgaaagaattacgt
tctatgttgatggaacaagatcctgatgtggctgttactgttcgaaagctggtaattgtt
tctctgatggagttatttaaagatattactccttcatataaaatccggcccctcacagaa
gcagaaaaatctactaagacccgaaaagaaacccagaagttaagagaatttgaagaaggc
ctggttagccaatacaagttttatttggaaaatctggaacaaatggttaaagattggaag
cagaggaagctgaagaaaagtaatgtagtttccttaaaggcatacaaaggactggcagaa
gtcgctgtgaagagcttgtgtgagctgttggtggcactacctcattttaactttcacaac
aacatcatcgtattgattgtccctctcatgaatgacatgtcaaaattgatatctgaaatg
tgttgtgaagctgtgaagaaactctttaagcaagataaattaggccaagcttctcttggt
gtaattaaagtgatttctggttttgtgaagggcagaaattacgaagttaggccagagatg
ttaaaaacatttttatgcctaagaatcaaggaagtagaagtgaaaaaagatacagaagac
attaataaaccaaaaaaatttatgactttcaaagaaaagagaaaatctctatcaagaatg
cagagaaagtggaagaaagcagaagagaaactagagcgagagcttcgagaggcagaagct
tcagagagtactgagaaaaaacttaaactgcacacagagactctgaatattgtgtttgta
acctacttcagaatattgaagaaggcccagaggtcacctctcctgccagcagttctagaa
ggtcttgccaagtttgctcaccttataaatgtggaattttttgatgatctgttagtagtt
cttcatactctcattgagtctggtgacctaagctatcaagaaagtcttcactgtgtccag
actgcttttcatattctttctggacaaggtgatgttctgaatattgatccattgaaattc
tacacacatctctacaaaacactgttcaaattacatgcaggtgctaccaatgaaggtgtt
gagattgtactccagtgccttgatgtcatgctaactaagcgcagaaagcaagtttctcag
cagcgagctcttgccttcatcaaacgcctttgtacccttgctcttcatgttcttccaaat
tcaagtattggcattttagcaactaccagaatattaatgcatactttccccaaaacagat
ctactgcttgacagtgaatctcagggaagtggagttttccttcctgaactggatgagcct
gagtactgcaatgctcagaacactgctctgtgggaactgcatgctctgcggaggcattat
catcccatagtgcagagatttgcagcccacctgatcgctggagcaccttctgaaggctct
ggagcactcaaaccagagttgagtcgaagatctgctactgaactttttgaggcatatagc
atggcagaaatgacattcaatcctcctgttgaatcttcaaaccccaaaataaagggtaaa
tttttacaaggggattcatttttgaatgaagatttaaatcagctaatcaaaagatactcc
agtgaagttgctactgaatcgcctctggatttcacgaaatatttgaaaacatcactacac
tag

DBGET integrated database retrieval system