KEGG   Homo sapiens (human): 643311Help
Entry
643311            CDS       T01001                                 

Gene name
CT47B1, CT47.13, CT47A13
Definition
(RefSeq) cancer/testis antigen family 47 member B1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CT47
Motif
Other DBs
NCBI-GeneID: 643311
NCBI-ProteinID: NP_001139190
OMIM: 300790
HGNC: 33293
Ensembl: ENSG00000236446
Vega: OTTHUMG00000187483
Pharos: P0C2W7(Tdark)
UniProt: P0C2W7
Position
Xq24
AA seq 299 aa AA seqDB search
MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDMVPAAEVVGVAGPVEG
LGEEEGEQAAGLAAVPQGGSAEEDSDIGPATEEEEEEEEGNEAANFDLAVATRRYPAAGI
GFVFLYLVHSLLRRLYHNDHIQIANRHLSRLMVGPHAAVPNLWDNPPLLLLSQRLGAGAA
APEGEGLGLIQEAASVQEAASVPEPAVPADLAEMAREPAEEAADEKPPEEAAEEKLTEEA
TEEPAAEEPTSEEAVAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDVENKVKNSKGT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacaggggaccgacacccgacccaaggggaccaggaggccccggtaagccag
gagggagcacaggccgaggcggccggagctggtaaccaggagggcggcgactccggcccc
gacagcagcgacatggtgcctgcggccgaggtggtcggagtcgcagggcccgtggaaggc
ctcggggaggaggagggtgagcaggcggcaggcctggccgcagtcccccagggcgggagc
gccgaggaggactcagatatcgggcccgcgacggaggaagaggaggaggaggaagagggg
aacgaggcggccaacttcgacttggcggtggccacccgtcggtacccggcggcgggcatt
ggcttcgtgttcctgtacctggtccactcccttctccgccgcctctatcacaacgaccac
atccagatagcgaaccgtcacctcagccgcctgatggtggggccccacgctgctgtgccc
aacctctgggacaaccctcccctgctgctgctgtcccagaggctgggtgcaggggctgca
gccccagaaggcgagggcctcggcctgatccaggaggctgcgtcggtccaggaggccgcg
tcggtcccagagcctgcagtgccagctgacctggccgagatggccagggagcccgcggag
gaggccgcagatgagaaacccccagaggaggccgcagaggagaagctcacagaggaggcc
acagaggaaccggccgcagaggaaccgacctcagaggaggccgtggcccccgaggaagtc
actaaatctcagcccgaaaagtgggatgaagaggcccaagatgctgcaggcgaggaagag
aaagaacaagaaaaagagaaggatgtggaaaacaaggtgaagaactccaaagggacctag

DBGET integrated database retrieval system