KEGG   Homo sapiens (human): 643394Help
Entry
643394            CDS       T01001                                 

Gene name
SPINK9, LEKTI2
Definition
(RefSeq) serine peptidase inhibitor, Kazal type 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Kazal_1 Kazal_2 HscB_4_cys PsbT
Motif
Other DBs
NCBI-GeneID: 643394
NCBI-ProteinID: NP_001035523
OMIM: 613511
HGNC: 32951
Ensembl: ENSG00000204909
Vega: OTTHUMG00000163431
Pharos: Q5DT21(Tbio)
UniProt: Q5DT21
Position
5q32
AA seq 86 aa AA seqDB search
MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT
YKNDCFFCSKVKKTDGTLKFVHFGKC
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaacagccatagtcctactcttggctctgacacttgcaaccatgttcagtata
gaatgtgccaaacagacgaaacagatggttgactgcagtcattataaaaagttaccacca
ggacaacagagattttgtcatcatatgtatgatccaatttgtggatctgatggcaaaact
tataaaaatgattgcttcttctgttctaaagttaagaaaactgacggcacacttaaattt
gtacattttggaaaatgttaa

DBGET integrated database retrieval system