KEGG   Homo sapiens (human): 643394
Entry
643394            CDS       T01001                                 

Gene name
SPINK9, LEKTI2
Definition
(RefSeq) serine peptidase inhibitor Kazal type 9
  KO
K23603  serine protease inhibitor Kazal-type 6/7/9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    643394 (SPINK9)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I1: Kazal family
   643394 (SPINK9)
SSDB
Motif
Pfam: Kazal_1 Kazal_2 HscB_4_cys EphA2_TM PsbT
Other DBs
NCBI-GeneID: 643394
NCBI-ProteinID: NP_001035523
OMIM: 613511
HGNC: 32951
Ensembl: ENSG00000204909
Vega: OTTHUMG00000163431
Pharos: Q5DT21(Tbio)
UniProt: Q5DT21
Position
5q32
AA seq 86 aa
MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT
YKNDCFFCSKVKKTDGTLKFVHFGKC
NT seq 261 nt   +upstreamnt  +downstreamnt
atgagagcaacagccatagtcctactcttggctctgacacttgcaaccatgttcagtata
gaatgtgccaaacagacgaaacagatggttgactgcagtcattataaaaagttaccacca
ggacaacagagattttgtcatcatatgtatgatccaatttgtggatctgatggcaaaact
tataaaaatgattgcttcttctgttctaaagttaagaaaactgacggcacacttaaattt
gtacattttggaaaatgttaa

DBGET integrated database retrieval system