KEGG   Homo sapiens (human): 6434Help
Entry
6434              CDS       T01001                                 

Gene name
TRA2B, Htra2-beta, PPP1R156, SFRS10, SRFS10, TRA2-BETA, TRAN2B
Definition
(RefSeq) transformer 2 beta homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6434 (TRA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    6434 (TRA2B)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6434 (TRA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6434 (TRA2B)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6434 (TRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 RRM_occluded Apt1 Presenilin
Motif
Other DBs
NCBI-GeneID: 6434
NCBI-ProteinID: NP_004584
OMIM: 602719
HGNC: 10781
Ensembl: ENSG00000136527
Vega: OTTHUMG00000156641
Pharos: P62995(Tbio)
UniProt: P62995
Structure
PDB: 

Position
3q27.2
AA seq 288 aa AA seqDB search
MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCL
GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSY
RGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcggcgagcagaactacggcgagcgggaatcccgttctgcttccagaagt
ggaagtgctcacggatcggggaaatctgcaaggcatacccctgcaaggtctcgctccaag
gaagattccaggcgttccagatcaaagtccaggtcccgatctgaatctaggtctagatcc
agaagaagctcccgaaggcattatacccggtcacggtctcgctcccgctcccatagacga
tcacgtagcaggtcttacagtcgagattatcgtagacggcacagccacagccattctccc
atgtctactcgcaggcgtcatgttgggaatcgggcaaatcctgatcctaactgttgtctt
ggagtatttgggctgagcttgtacaccacagaaagagatctaagagaagtgttctctaaa
tatggtcccattgccgatgtgtctattgtatatgaccagcagtctaggcgttcaagagga
tttgcctttgtatattttgaaaatgtagatgatgccaaggaagctaaagaacgtgccaat
ggaatggagcttgatgggcgtaggatcagagttgatttctctataacaaaaagaccacat
acgccaacaccaggaatttacatggggagacctacctatggcagctctcgccgtcgggat
tactatgacagaggatatgatcggggctatgatgatcgggactactatagcagatcatac
agaggaggaggtggaggaggaggaggatggagagctgcccaagacagggatcagatttat
agaaggcggtcaccttctccttactatagtcgtggaggatacagatcacgttccagatct
cgatcatactcacctcgtcgctattaa

DBGET integrated database retrieval system