KEGG   Homo sapiens (human): 643664
Entry
643664            CDS       T01001                                 

Symbol
SLC35G6, AMAC1L3, TMEM21B
Name
(RefSeq) solute carrier family 35 member G6
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 643664
NCBI-ProteinID: NP_001096084
HGNC: 31351
Ensembl: ENSG00000259224
Vega: OTTHUMG00000187017
Pharos: P0C7Q6(Tdark)
UniProt: P0C7Q6
Position
17p13.1
AA seq 338 aa
MAGSHPYLNPPDSTHPSPPSAPPSLRWHQCCQPSDATNGLLVALLGGGLPAGFVGPLSHM
AYQASNLPSLELLICRCLFHLPIALLLKLRGDPLLGPPDIRGRAYFYALLNVLSIGCAYS
AVQVVPAGNAATVRKGSSTVCSAVLTLCLESQGLSGYDWCGLLGSILGLIIIVGPGLWTL
QEGITGVYTALGYGQAFVGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGSVPGLFV
LQPPVLPSDLPSWSCVGAVGILALVSFTCVSYAVTKAHPALVCAVLHSEVVVALILQYYM
LHETVAPSDIVGAGVVLGSIAIITAWNLSCEREGKVEE
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctggcagtcacccctacttgaacccgcctgactccacacacccatcgccgccctcc
gctccacccagcctccgctggcaccagtgctgccagccctctgatgccaccaatggcctg
ctggtggccctgctgggtgggggcctgcctgctggcttcgtgggccccctttctcatatg
gcttaccaggcttccaacctgccctcgctggagctgctcatctgtcgatgcctcttccac
ctccctattgccctgctacttaaactgcgtggcgacccccttctgggacctcctgacatc
cgaggccgggcctacttctatgccctgctcaacgtcctcagcattggatgtgcctacagt
gcggttcaggtggtgcccgctggcaacgctgccactgttcgcaaaggttcttccaccgtc
tgctccgccgtcctcaccctctgccttgagagccagggtctcagtggctacgactggtgt
ggactgttgggcagcatcctaggactaatcatcattgtgggacctggactctggacacta
caggaggggatcacgggtgtctacaccgccctgggctatgggcaggctttcgtgggagga
ctggcgctgtccctggggcttctggtctatcgttctctgcactttccctcctgcctccca
acagtggccttcctatctggcttggtggggctgctgggctctgtgccaggcctctttgtg
ctgcagccccccgtgttgcccagtgatctcccgagttggagttgtgtgggggcagtgggg
atcctcgccttggtctccttcacatgtgtgagctatgcggtcaccaaggcccaccctgcc
ctggtgtgcgctgtcctgcattccgaggtggtggtggcccttatactgcagtattatatg
ctccatgagactgtggcaccttctgacatcgtgggggcaggggttgtgctgggcagcatt
gccatcatcacagcctggaacctcagctgtgagagggaagggaaggtggaggagtga

DBGET integrated database retrieval system