KEGG   Homo sapiens (human): 64386Help
Entry
64386             CDS       T01001                                 

Gene name
MMP25, MMP-25, MMP20, MMP20A, MMPL1, MT-MMP_6, MT-MMP6, MT6-MMP, MT6MMP, MTMMP6
Definition
(RefSeq) matrix metallopeptidase 25
  KO
K08003  matrix metalloproteinase-25 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    64386 (MMP25)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    64386 (MMP25)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     64386 (MMP25)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   64386 (MMP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Peptidase_M66 Astacin Metallopep Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 64386
NCBI-ProteinID: NP_071913
OMIM: 608482
HGNC: 14246
Ensembl: ENSG00000008516
Vega: OTTHUMG00000177475
Pharos: Q9NPA2(Tchem)
UniProt: Q9NPA2
Position
16p13.3
AA seq 562 aa AA seqDB search
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
GRWPAPIPLLLLPLLVGGVASR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcggctccggcttctggcgctgctgcttctgctgctggcaccgcccgcgcgc
gccccgaagccctcggcgcaggacgtgagcctgggcgtggactggctgactcgctatggt
tacctgccgccaccccaccctgcccaggcccagctgcagagccctgagaagttgcgcgat
gccatcaaagtcatgcagaggttcgcggggctgccggagaccggccgcatggacccaggg
acagtggccaccatgcgtaagccccgctgctccctgcctgacgtgctgggggtggcgggg
ctggtcaggcggcgtcgccggtacgctctgagcggcagcgtgtggaagaagcgaaccctg
acatggagggtacgttccttcccccagagctcccagctgagccaggagaccgtgcgggtc
ctcatgagctatgccctgatggcctggggcatggagtcaggcctcacatttcatgaggtg
gattccccccagggccaggagcccgacatcctcatcgactttgcccgcgccttccaccag
gacagctaccccttcgacgggttggggggcaccctagcccatgccttcttccctggggag
caccccatctccggggacactcactttgacgatgaggagacctggacttttgggtcaaaa
gacggcgaggggaccgacctgtttgccgtggctgtccatgagtttggccacgccctgggc
ctgggccactcctcagcccccaactccattatgaggcccttctaccagggtccggtgggc
gaccctgacaagtaccgcctgtctcaggatgaccgcgatggcctgcagcaactctatggg
aaggcgccccaaaccccatatgacaagcccacaaggaaacccctggctcctccgccccag
cccccggcctcgcccacacacagcccatccttccccatccctgatcgatgtgagggcaat
tttgacgccatcgccaacatccgaggggaaactttcttcttcaaaggcccctggttctgg
cgcctccagccctccggacagctggtgtccccgcgacccgcacggctgcaccgcttctgg
gaggggctgcccgcccaggtgagggtggtgcaggccgcctatgctcggcaccgagacggc
cgaatcctcctctttagcgggccccagttctgggtgttccaggaccggcagctggagggc
ggggcgcggccgctcacggagctggggctgcccccgggagaggaggtggacgccgtgttc
tcgtggccacagaacgggaagacctacctggtccgcggccggcagtactggcgctacgac
gaggcggcggcgcgcccggaccccggctaccctcgcgacctgagcctctgggaaggcgcg
cccccctcccctgacgatgtcaccgtcagcaacgcaggtgacacctacttcttcaagggc
gcccactactggcgcttccccaagaacagcatcaagaccgagccggacgccccccagccc
atggggcccaactggctggactgccccgccccgagctctggtccccgcgcccccaggccc
cccaaagcgacccccgtgtccgaaacctgcgattgtcagtgcgagctcaaccaggccgca
ggacgttggcctgctcccatcccgctgctcctcttgcccctgctggtggggggtgtagcc
tcccgctga

DBGET integrated database retrieval system