KEGG   Homo sapiens (human): 6439
Entry
6439              CDS       T01001                                 
Symbol
SFTPB, PSP-B, SFTB3, SFTP3, SMDP1, SP-B
Name
(RefSeq) surfactant protein B
Organism
hsa  Homo sapiens (human)
Disease
H01122  Congenital pulmonary alveolar proteinosis
SSDB
Motif
Pfam: SapB_2 SapA SapB_1
Other DBs
NCBI-GeneID: 6439
NCBI-ProteinID: NP_000533
OMIM: 178640
HGNC: 10801
Ensembl: ENSG00000168878
Pharos: P07988(Tbio)
UniProt: P07988 D6W5L6
Structure
Position
2:complement(85657307..85668741)
AA seq 381 aa
MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVW
GHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYF
PLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPV
LPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPL
VAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECH
LCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTC
QALGVCGTMSSPLQCIHSPDL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggctgagtcacacctgctgcagtggctgctgctgctgctgcccacgctctgtggccca
ggcactgctgcctggaccacctcatccttggcctgtgcccagggccctgagttctggtgc
caaagcctggagcaagcattgcagtgcagagccctagggcattgcctacaggaagtctgg
ggacatgtgggagccgatgacctatgccaagagtgtgaggacatcgtccacatccttaac
aagatggccaaggaggccattttccaggacacgatgaggaagttcctggagcaggagtgc
aacgtcctccccttgaagctgctcatgccccagtgcaaccaagtgcttgacgactacttc
cccctggtcatcgactacttccagaaccagactgactcaaacggcatctgtatgcacctg
ggcctgtgcaaatcccggcagccagagccagagcaggagccagggatgtcagaccccctg
cccaaacctctgcgggaccctctgccagaccctctgctggacaagctcgtcctccctgtg
ctgcccggggccctccaggcgaggcctgggcctcacacacaggatctctccgagcagcaa
ttccccattcctctcccctattgctggctctgcagggctctgatcaagcggatccaagcc
atgattcccaagggtgcgctagctgtggcagtggcccaggtgtgccgcgtggtacctctg
gtggcgggcggcatctgccagtgcctggctgagcgctactccgtcatcctgctcgacacg
ctgctgggccgcatgctgccccagctggtctgccgcctcgtcctccggtgctccatggat
gacagcgctggcccaaggtcgccgacaggagaatggctgccgcgagactctgagtgccac
ctctgcatgtccgtgaccacccaggccgggaacagcagcgagcaggccataccacaggca
atgctccaggcctgtgttggctcctggctggacagggaaaagtgcaagcaatttgtggag
cagcacacgccccagctgctgaccctggtgcccaggggctgggatgcccacaccacctgc
caggccctcggggtgtgtgggaccatgtccagccctctccagtgtatccacagccccgac
ctttga

DBGET integrated database retrieval system