KEGG   Homo sapiens (human): 64393
Entry
64393             CDS       T01001                                 

Gene name
ZMAT3, PAG608, WIG-1, WIG1
Definition
(RefSeq) zinc finger matrin-type 3
  KO
K10137  zinc finger, matrin type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    64393 (ZMAT3)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met TUTase zf-C2H2_2 zf-U1
Other DBs
NCBI-GeneID: 64393
NCBI-ProteinID: NP_071915
OMIM: 606452
HGNC: 29983
Ensembl: ENSG00000172667
Vega: OTTHUMG00000157290
Pharos: Q9HA38(Tbio)
UniProt: Q9HA38
Position
3q26.32
AA seq 289 aa
MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQD
CALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPA
ATPVVPVPPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSESSELGQRRARKEGNEFKMMPNRRNMYTVQNNSAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgatcctcttgcaacacgccgtgcttcctccacctaagcagccctcaccctcgcctcct
atgtcagtggccaccaggtctacaggaaccttgcagcttccaccacagaagccttttggg
caggaggcttccttgcctcttgcaggggaagaagagttatcgaagggaggggagcaagac
tgtgccctggaggagctatgtaagcccctgtactgcaaactctgcaatgtcaccttgaac
tctgcacagcaagcccaggctcattatcagggtaaaaatcatggtaagaaactccgaaat
tactatgcagcaaatagctgtcctcctcctgctagaatgagcaatgtggtcgagcctgca
gctactccagttgttccagtccctccgcagatgggctcctttaagccaggaggccgagtg
atcctggccacggagaatgattactgtaagctctgtgatgcctccttcagttccccagct
gtggctcaggctcactatcaagggaagaatcatgccaagaggctgcggctggcggaagct
cagagtaactcattctcggaatcctcagagctgggtcaacggcgggccaggaaagaaggg
aatgagtttaagatgatgcctaacaggagaaatatgtatacagtacagaataattcagca
ggtccttacttcaatccccgctctcggcagagaattccacgtgatctggccatgtgtgtt
actccaagtggccagttttactgctcaatgtgtaatgttggagctggcgaagagatggaa
ttccggcagcatttagagagcaagcaacataagagcaaggtgtctgaacagcggtacagg
aatgagatggagaatctgggatatgtatag

DBGET integrated database retrieval system