KEGG   Homo sapiens (human): 64397Help
Entry
64397             CDS       T01001                                 

Gene name
ZNF106, SH3BP3, ZFP106, ZNF474
Definition
(RefSeq) zinc finger protein 106
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 WD40_like zf-C2H2_aberr
Motif
Other DBs
NCBI-GeneID: 64397
NCBI-ProteinID: NP_071918
HGNC: 12886
Ensembl: ENSG00000103994
Vega: OTTHUMG00000173244
Pharos: Q9H2Y7(Tdark)
UniProt: Q9H2Y7
Position
15q15.1
AA seq 1883 aa AA seqDB search
MPVGRIECPSSPSFPRDISHECRVCGVTEVGLSAYAKHISGQLHKDNVDAQEREDDGKGE
EEEEDYFDKELIQLIKQRKEQSRQDEPSNSNQEINSDDRRPQWRREDRIPYQDRESYSQP
AWHHRGPPQRDWKWEKDGFNNTRKNSFPHSLRNGGGPRGRSGWHKGVAGGSSTWFHNHSN
SGGGWLSNSGAVDWNHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSVRSTNNWNYSGP
GDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSEG
FTSDKFPSEGLLDFNFEQLESQTTKQADTATSKVSGKNGSAAREKPRRWTPYPSQKTLDL
QSGLKDITGNKSEMIEKPLFDFSLITTGIQEPQTDETRNSPTQKTQKEIHTGSLNHKASS
DSAASFEVVRQCPTAEKPEQEHTPNKMPSLKSPLLPCPATKSLSQKQDPKNISKNTKTNF
FSPGEHSNPSNKPTVEDNHGPYISKLRSSCPHVLKGNKSTFGSQKQSGDNLNDTLRKAKE
VLQCHESLQNPLLSTSKSTRNYAKASRNVEESEKGSLKIEFQVHALEDESDGETSDTEKH
GTKIGTLGSATTELLSGSTRTADEKEEDDRILKTSRELSTSPCNPIVRQKESELQMTSAA
SPHPGLLLDLKTSLEDAQVDDSIKSHVSYETEGFESASLDAELQKSDISQPSGPLLPELS
KLGFPASLQRDLTRHISLKSKTGVHLPEPNLNSARRIRNISGHRKSETEKESGLKPTLRQ
ILNASRRNVNWEQVIQQVTKKKQELGKGLPRFGIEMVPLVQNEQEALDLDGEPDLSSLEG
FQWEGVSISSSPGLARKRSLSESSVIMDRAPSVYSFFSEEGTGKENEPQQMVSPSNSLRA
GQSQKATMHLKQEVTPRAASLRTGERAENVATQRRHSAQLSSDHIIPLMHLAKDLNSQER
SIPPSENQNSQESNGEGNCLSSSASSALAISSLADAATDSSCTSGAEQNDGQSIRKKRRA
TGDGSSPELPSLERKNKRRKIKGKKERSQVDQLLNISLREEELSKSLQCMDNNLLQARAA
LQTAYVEVQRLLMLKQQITMEMSALRTHRIQILQGLQETYEPSEHPDQVPCSLTRERRNS
RSQTSIDAALLPTPFFPLFLEPPSSHVSPSPTGASLQITTSPTFQTHGSVPAPDSSVQIK
QEPMSPEQDENVNAVPPSSACNVSKELLEANREISDSCPVYPVITARLSLPESTESFHEP
SQELKFSVEQRNTRNRENSPSSQSAGLSSINKEGEEPTKGNSGSEACTSSFLRLSFASET
PLEKEPHSPADQPEQQAESTLTSAETRGSKKKKKLRKKKSLRAAHVPENSDTEQDVLTVK
PVRKVKAGKLIKGGKVTTSTWEDSRTGREQESVRDEPDSDSSLEVLEIPNPQLEVVAIDS
SESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVSVAETQTVI
SSIKGSKNSSEISSEPGDDDEPTEGSFEGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVS
RKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLC
LHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDC
TISVRDARNGLLLRTLEGHSKTILCMKVVNDLVFSGSSDQSVHAHNIHTGELVRIYKGHN
HAVTVVNILGKVMVTACLDKFVRVYELQSHDRLQVYGGHKDMIMCMTIHKSMIYTGCYDG
SIQAVRLNLMQNYRCWWHGCSLIFGVVDHLKQHLLTDHTNPNFQTLKCRWKNCDAFFTAR
KGSKQDAAGHIERHAEDDSKIDS
NT seq 5652 nt NT seq  +upstreamnt  +downstreamnt
atgccagtggggagaattgaatgtccctcatctccctctttccctagggacattagtcat
gagtgccgagtgtgcggggtcacagaagtgggtctttctgcatatgcaaagcacatttct
ggccagttgcacaaagataacgttgatgcccaggaaagagaagatgatggaaaaggagag
gaagaggaagaagattattttgacaaggaactcattcagttaataaaacaaaggaaagaa
caaagtcgacaagatgaaccttccaatagcaaccaagaaataaactctgatgacagacga
ccccaatggagacgagaagaccgaattccttaccaagacagagagagttacagtcagcct
gcatggcatcatcgtggacctccacagcgggattggaaatgggaaaaagatggctttaat
aatactaggaaaaacagctttccacattctttgaggaatggtggtggaccaagaggacgt
tccgggtggcataagggtgttgcaggaggctcctcgacttggtttcacaaccatagtaat
tctggaggtggttggctttcaaatagtggagcagtagattggaatcataatggtacagga
aggaattccagttggctttctgaaggaacaggtggcttttccagttggcatatgaacaac
agtaacggaaactggaaatccagtgtacgtagtacaaataattggaattacagtggccct
ggagacaaatttcaaccaggcagaaacagaaattctaactgtcaaatggaagacatgact
atgctatggaacaagaaatctaataagtcaaacaaatacagtcacgacagatataattgg
cagcggcaagaaaatgacaaacttggtacagttgccacatatagaggtccttctgaagga
tttacaagtgataaatttccttcagaaggcttactcgacttcaattttgagcagctggaa
agccaaaccactaaacaagcagacactgctacttccaaagttagtggaaagaatggcagt
gcggcaagggaaaagcctcgtcgctggacgccttacccttctcagaagactctggattta
cagtcgggattgaaagacatcactggtaacaagtcagaaatgatagagaaacctctcttt
gattttagcttgataactacaggaatacaggagccccaaactgatgaaacacgtaattcc
ccaacacagaaaacacaaaaagaaatacatactggatctcttaatcacaaggcctcttct
gattccgctgcttccttcgaggtggtgagacagtgccccactgcagaaaaacctgaacaa
gagcatacaccaaataaaatgccatcattgaaatccccactccttccatgtccagccact
aaatcattgtctcaaaagcaagatccaaagaatatctcaaaaaacaccaaaacaaatttt
ttttcccctggagaacactcaaatccctcgaacaagcccactgtggaagataaccatggt
ccttacatatccaaactgcgtagttcatgtcctcatgttttaaaagggaataaaagtaca
tttggctctcaaaagcaatctggtgataatttaaatgatactttacgaaaggccaaagag
gtgctacagtgtcatgagtcattgcaaaatccacttcttagcacttctaaaagtaccagg
aactatgcaaaagcaagtagaaatgtagaagaatctgaaaaagggtctttgaaaattgag
tttcaagtgcacgcactagaagatgaaagtgatggagagacatctgacacggaaaagcat
ggaacaaaaattggaaccctaggttctgcaactacagaattgttatctggcagcactcga
actgctgatgagaaagaggaggatgaccgcatcctgaagacttctagagagctatccact
tccccatgtaatcccatagttcgccagaaagaatctgaattacaaatgacatctgcagcc
agtccacaccctggcttattgctagacttgaaaacctctctagaagatgcacaggttgat
gactctattaaatctcatgtatcttatgaaacagaaggctttgagagtgctagcttggat
gcagagcttcaaaaaagtgacatcagtcagccctcgggccctctcctgcctgaactaagt
aagcttggctttcctgcctcacttcagagggatctaacccggcacattagtttgaagagc
aaaactggagtacaccttcctgagccaaacctcaatagtgcccgccgcattcgcaatatt
agcggtcaccgaaagagtgagacagagaaggagtctgggctcaagccaaccctacggcag
attctaaatgcatctcggagaaatgtcaactgggaacaggtcattcagcaagtaaccaag
aaaaagcaagagctgggcaaaggcttacccaggtttggcatagaaatggtaccccttgtt
caaaatgaacaagaagccttagatttggatggggaacctgatctgtccagtctagaagga
ttccagtgggaaggtgtttccatttcctcgtcccctggcttggcaagaaagcgaagcctt
tctgagagcagcgtgatcatggacagagctccttctgtgtatagcttcttcagtgaggaa
ggtacaggcaaagaaaatgagccccagcagatggtttcacctagtaactcattgagggct
ggacagagccagaaagcaaccatgcacctcaaacaagaagtgacacctcgggctgcctcc
ctccgaacaggtgaaagggctgaaaatgttgctacccaaaggcgacatagtgcacaatta
tcctctgaccatataatacctttgatgcatttggcaaaagacttgaacagccaggagagg
tctataccaccgtcagagaatcagaattcccaggagagtaatggagagggaaactgtctg
tcatcaagcgcatcctcagcccttgcgatctccagtttagcggatgcagccacagatagt
agctgtacctctggtgctgaacaaaatgatggccaaagtattagaaagaaacgaagagcc
actggagatggatcttctcctgaactcccaagtcttgagagaaaaaataaaagaaggaaa
attaaaggaaaaaaagaacgttctcaggttgaccagctgctgaatatttctttaagggag
gaagaacttagtaagtcattgcagtgcatggataacaatcttctgcaagcccgtgcagcc
cttcagacagcttatgtggaagttcagaggctacttatgctcaagcagcagataactatg
gagatgagtgcactgaggacccatagaatacagattctacagggattacaagaaacatat
gaaccttctgagcacccagaccaggttccctgtagcctcacacgagaacgaaggaacagt
agatctcaaacatccattgatgccgcactgctgcccactccctttttcccactttttctg
gagcctccatcttcccatgtgtctccatcacccaccggagcctctcttcaaataaccacg
tctcctactttccaaacccatggcagtgtccctgctccagactcatcagttcagattaaa
caagagcccatgtctcctgaacaagatgagaatgtgaatgctgtgccaccaagctctgcc
tgcaatgtgtccaaggaattactggaagctaatagagagatcagtgacagttgtccagtt
tatccagtcatcactgctagattgtccttaccagagtcaacagaaagtttccatgagcct
agccaagaactgaagttttctgtggagcaaagaaataccagaaacagagaaaactctccc
tcttcccaatcagctggtctttctagcataaataaagaaggggaagagccaaccaaaggc
aatagtgggtctgaagcctgtaccagttcttttctaagattgtcttttgcttcagaaacc
cctttggagaaggaaccccactctccagctgaccagcctgaacaacaggcagaatccact
ttgacatcagctgagactaggggaagcaagaaaaagaagaaactccggaagaagaaaagt
ctacgggctgcccatgttcctgagaatagtgacactgaacaggatgttttgactgttaaa
cctgtaaggaaagtaaaagctggaaagttaattaaaggggggaaagtaacaacctccact
tgggaagacagcaggactggtcgggagcaggagagtgtcagagatgagccagatagtgac
tcgtctctggaagtcctagaaattcctaatcctcagttagaagtagtagccattgattct
tcagaatcaggagaagagaaaccagacagcccatctaaaaaggatatttggaactctaca
gagcaaaacccactagaaacgtctcgttctgggtgtgatgaagttagctctaccagtgaa
attggcactcgctataaagatggcatccctgtaagtgtggcagaaactcagactgtgatc
tcctccataaaaggatcaaagaattcttcagaaatatcttcagagccaggagatgatgat
gaacccacagaaggaagctttgagggacaccaagctgccgtaaatgcaattcagatattt
gggaacttgctatatacctgttcagcagataaaactgttcgggtttataatctggtgagt
cggaaatgtattggtgtctttgagggtcatacctccaaagttaactgcctcctggttact
cagacctccgggaagaatgctgccctttacaccgggtccagtgaccataccatccgctgc
tataatgttaagagccgagagtgtgtggagcagttacagctggaagaccgggtcctctgc
ctccacagtagatggcgaatcctctatgcgggactggcaaatggcactgtggtcaccttc
aacataaagaacaacaaacgacttgagatctttgaatgccatggccctcgggcagtcagc
tgtcttgctacagctcaggaaggtgcccgaaaactgctggtcgtggggtcttatgactgc
acaattagtgtacgcgatgcccggaatggactgctcctcagaactctggagggccatagc
aaaaccattctttgcatgaaggtggtgaatgatctcgtgttcagtggctccagtgatcag
tcagtccatgctcacaacattcacactggtgagctcgtgcggatctataaaggtcacaat
catgcagtgactgtggtgaatatcctaggaaaagtgatggtgactgcttgcctggataaa
tttgttcgtgtctatgaattacagtctcatgatcgattacaagtttatggaggacacaaa
gacatgattatgtgtatgaccatccataaaagcatgatttacactggctgttatgatggc
agtattcaggccgtgaggcttaatctgatgcagaattaccgctgttggtggcatggttgc
tctctgatatttggcgttgtagatcatttaaaacaacacttgctgaccgaccacactaat
cccaacttccagactctgaaatgtcgctggaagaactgcgatgcttttttcactgctagg
aaaggatccaaacaggatgctgcaggacatattgaacgacatgctgaagatgacagcaaa
attgattcatga

DBGET integrated database retrieval system