KEGG   Homo sapiens (human): 64398Help
Entry
64398             CDS       T01001                                 

Gene name
MPP5, PALS1
Definition
(RefSeq) membrane palmitoylated protein 5
  KO
K06091  MAGUK p55 subfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
N00344  CRB3-Pals1-PATJ complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    64398 (MPP5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    64398 (MPP5)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    64398 (MPP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin L27_N SH3_2 PDZ PDZ_6 L27 SH3_1 PDZ_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 64398
NCBI-ProteinID: NP_071919
OMIM: 606958
HGNC: 18669
Ensembl: ENSG00000072415
Vega: OTTHUMG00000171243
Pharos: Q8N3R9(Tbio)
UniProt: Q8N3R9 Q658X5
Structure
PDB: 

Position
14q23.3
AA seq 675 aa AA seqDB search
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVK
ILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPF
PLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDE
RVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcccatatgaatgggcatgttacagaggaatcagacagcgaagtaaaaaat
gttgatcttgcatcaccagaggaacatcagaagcaccgagagatggctgttgactgccct
ggagatttgggcaccaggatgatgccaatacgtcgaagtgcacagttggagcgtattcgg
caacaacaggaggacatgaggcgtaggagagaggaagaagggaaaaagcaagaacttgac
cttaattcttccatgagacttaagaaactagcccaaattcctccaaagaccggaatagat
aaccctatgtttgatacagaggaaggaattgtcttagaaagtcctcattatgctgtgaaa
atattagaaatagaagacttgttttcttcacttaaacatatccaacatactttggtagat
tctcagagccaggaggatatttcactgcttttacaacttgttcaaaataaggatttccag
aatgcatttaagatacacaatgccatcacagtacacatgaacaaggccagtcctccattt
cctcttatctccaacgcacaagatcttgctcaagaggtacaaactgttttgaagccagtt
catcataaggaaggacaagaactaactgctttgctgaatactccacatattcaggcactt
ttactggcccacgataaggttgctgagcaggaaatgcagctagagcccattacagatgag
agagtttatgaaagtattggccagtatggaggagaaactgtaaaaatagttcgtatagaa
aaggctcgtgatattccgttgggtgctacagttcgtaatgaaatggactctgtcatcatt
agccggatagtaaaagggggtgctgcagagaaaagtggtctgttgcatgaaggagatgaa
gttctagagattaatggcattgaaattcgggggaaagatgtcaatgaggtttttgacttg
ttgtctgatatgcatggtactttgacttttgtcctgattcccagtcaacagatcaagccg
cctcctgccaaggaaacagtaatccatgtaaaagctcattttgactatgacccctcagat
gacccttatgttccatgtcgagagttaggtctgtcttttcaaaaaggtgatatacttcat
gtgatcagtcaagaagatccaaactggtggcaggcctacagggaaggggacgaagataat
caacctctagccgggcttgttccagggaaaagctttcagcagcaaagggaagccatgaaa
caaaccatagaagaagataaggagccagaaaaatcaggaaaactgtggtgtgcaaagaag
aataaaaagaagaggaaaaaggttttatataatgccaataaaaatgatgattatgacaac
gaggagatcttaacctatgaggaaatgtcactttatcatcagccagcaaataggaagaga
cctatcatcttgattggtccacagaactgtggccagaatgaattgcgtcagaggctcatg
aacaaagaaaaggaccgctttgcatctgcagttcctcatacaacccggagtaggcgagac
caagaagtagccggtagagattaccactttgtttcgcggcaagcattcgaggcagacata
gcagctggaaagttcattgagcatggtgaatttgagaagaatttgtatggaactagcata
gattctgtacggcaagtgatcaactctggcaaaatatgtcttttaagtcttcgtacacag
tcattgaagactctccggaattcagatttgaaaccatatattatcttcattgcaccccct
tcacaagaaagacttcgggcattattggccaaagaaggcaagaatccaaagcctgaagag
ttgagagaaatcattgagaagacaagagagatggagcagaacaatggccactactttgat
acggcaattgtgaattccgatcttgataaagcctatcaggaattgcttaggttaattaac
aaacttgatactgaacctcagtgggtaccatccacttggctgaggtga

DBGET integrated database retrieval system