KEGG   Homo sapiens (human): 643988
Entry
643988            CDS       T01001                                 
Symbol
FNDC10, C1orf233
Name
(RefSeq) fibronectin type III domain containing 10
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5579
Other DBs
NCBI-GeneID: 643988
NCBI-ProteinID: NP_001229588
HGNC: 42951
Ensembl: ENSG00000228594
Pharos: F2Z333(Tdark)
UniProt: F2Z333
Position
1:complement(1598012..1600135)
AA seq 226 aa
MRAPPLLLLLAACAPPPCAAAAPTPPGWEPTPDAPWCPYKVLPEGPEAGGGRLCFRSPAR
GFRCQAPGCVLHAPAGRSLRASVLRNRSVLLQWRLAPAAARRVRAFALNCSWRGAYTRFP
CERVLLGASCRDYLLPDVHDSVLYRLCLQPLPLRAGPAAAAPETPEPAECVEFTAEPAGM
QDIVVAMTAVGGSICVMLVVICLLVAYITENLMRPALARPGLRRHP
NT seq 681 nt   +upstreamnt  +downstreamnt
atgcgcgccccgccgctgctgctgctgctggccgcctgcgcgccgccgccctgcgccgcg
gccgccccgacgccgccgggctgggagccgacccccgacgcgccctggtgcccctacaag
gtgctgcccgagggccccgaggcgggcggcgggcgcctgtgcttccgcagccccgcgcgc
ggcttccgctgccaggctccgggctgcgtgctgcacgccccggccggccgctccctgcgc
gccagcgtcctgcgcaaccgcagcgtcctcctgcagtggcgcctggccccggccgccgcg
cgccgcgtgcgcgccttcgcgctcaactgctcgtggcgcggcgcctacacgcgcttcccg
tgcgagcgcgtgctcctcggggcctcctgccgcgactacctgctgcccgacgtgcacgac
agcgtcctctaccgcctgtgcctgcagccgctgccgctgcgcgctgggcccgccgccgcc
gcgccagagacccccgagccggccgagtgcgtggagttcaccgccgagccggccggcatg
caggacatcgtggtggccatgacggcggtgggcggctccatctgcgtcatgctggtggtc
atctgcctgctggtggcctacatcaccgagaacctcatgcgcccggccctcgcgcgcccc
ggcctgcgcagacacccctga

DBGET integrated database retrieval system