KEGG   Homo sapiens (human): 644Help
Entry
644               CDS       T01001                                 

Gene name
BLVRA, BLVR, BVR, BVRA
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
Disease
H01936  Hyperbiliverdinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    644 (BLVRA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     644 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA NAD_binding_3 NEXCaM_BD
Motif
Other DBs
NCBI-GeneID: 644
NCBI-ProteinID: NP_000703
OMIM: 109750
HGNC: 1062
Ensembl: ENSG00000106605
Vega: OTTHUMG00000128953
Pharos: P53004(Tbio)
UniProt: P53004 A0A140VJF4
Structure
PDB: 

Position
7p13
AA seq 296 aa AA seqDB search
MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLE
DALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKV
LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF
GELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLEN
VPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagagcccgagaggaagtttggcgtggtggtggttggtgttggccgagccggc
tccgtgcggatgagggacttgcggaatccacacccttcctcagcgttcctgaacctgatt
ggcttcgtgtcgagaagggagctcgggagcattgatggagtccagcagatttctttggag
gatgctctttccagccaagaggtggaggtcgcctatatctgcagtgagagctccagccat
gaggactacatcaggcagttccttaatgctggcaagcacgtccttgtggaataccccatg
acactgtcattggcggccgctcaggaactgtgggagctggctgagcagaaaggaaaagtc
ttgcacgaggagcatgttgaactcttgatggaggaattcgctttcctgaaaaaagaagtg
gtggggaaagacctgctgaaagggtcgctcctcttcacagctggcccgttggaagaagag
cggtttggcttccctgcattcagcggcatctctcgcctgacctggctggtctccctcttt
ggggagctttctcttgtgtctgccactttggaagagcgaaaggaagatcagtatatgaaa
atgacagtgtgtctggagacagagaagaaaagtccactgtcatggattgaagaaaaagga
cctggtctaaaacgaaacagatatttaagcttccatttcaagtctgggtccttggagaat
gtgccaaatgtaggagtgaataagaacatatttctgaaagatcaaaatatatttgtccag
aaactcttgggccagttctctgagaaggaactggctgctgaaaagaaacgcatcctgcac
tgcctggggcttgcagaagaaatccagaaatattgctgttcaaggaagtaa

DBGET integrated database retrieval system