KEGG   Homo sapiens (human): 6441Help
Entry
6441              CDS       T01001                                 

Gene name
SFTPD, COLEC7, PSP-D, SFTP4, SP-D
Definition
(RefSeq) surfactant protein D
  KO
K10068  pulmonary surfactant-associated protein D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    6441 (SFTPD)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    6441 (SFTPD)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   6441 (SFTPD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Surfac_D-trimer Lectin_C DUF4982 DUF3138 NPV_P10
Motif
Other DBs
NCBI-GeneID: 6441
NCBI-ProteinID: NP_003010
OMIM: 178635
HGNC: 10803
Ensembl: ENSG00000133661
Vega: OTTHUMG00000018590
Pharos: P35247(Tbio)
UniProt: P35247
Structure
PDB: 

Position
10q22.3
AA seq 375 aa AA seqDB search
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPR
GEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNT
GAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQH
LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAAL
QQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDRACGEKRLVVCEF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcttcctcctctctgcactggtcctgctcacacagcccctgggctacctggaa
gcagaaatgaagacctactcccacagaacaatgcccagtgcttgcaccctggtcatgtgt
agctcagtggagagtggcctgcctggtcgcgatggacgggatgggagagagggccctcgg
ggcgagaagggggacccaggtttgccaggagctgcagggcaagcagggatgcctggacaa
gctggcccagttgggcccaaaggggacaatggctctgttggagaacctggaccaaaggga
gacactgggccaagtggacctccaggacctcccggtgtgcctggtccagctggaagagaa
ggtcccctggggaagcaggggaacataggacctcagggcaagccaggcccaaaaggagaa
gctgggcccaaaggagaagtaggtgccccaggcatgcagggctcggcaggggcaagaggc
ctcgcaggccctaagggagagcgaggtgtccctggtgagcgtggagtccctggaaacaca
ggggcagcagggtctgctggagccatgggtccccagggaagtccaggtgccaggggaccc
ccgggattgaagggggacaaaggcattcctggagacaaaggagcaaagggagaaagtggg
cttccagatgttgcttctctgaggcagcaggttgaggccttacagggacaagtacagcac
ctccaggctgctttctctcagtataagaaagttgagctcttcccaaatggccaaagtgtc
ggggagaagattttcaagacagcaggctttgtaaaaccatttacggaggcacagctgctg
tgcacacaggctggtggacagttggcctctccacgctctgccgctgagaatgccgccttg
caacagctggtcgtagctaagaacgaggctgctttcctgagcatgactgattccaagaca
gagggcaagttcacctaccccacaggagagtccctggtctattccaactgggccccaggg
gagcccaacgatgatggcgggtcagaggactgtgtggagatcttcaccaatggcaagtgg
aatgacagggcttgtggagaaaagcgtcttgtggtctgcgagttctga

DBGET integrated database retrieval system