KEGG   Homo sapiens (human): 644139
Entry
644139            CDS       T01001                                 

Gene name
PIRT
Definition
(RefSeq) phosphoinositide interacting regulator of transient receptor potential channels
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PIRT TMEM100 Neurensin Phage_holin_3_6 Gram_pos_anchor
Other DBs
NCBI-GeneID: 644139
NCBI-ProteinID: NP_001094857
OMIM: 612068
HGNC: 37239
Ensembl: ENSG00000233670
Vega: OTTHUMG00000178234
Pharos: P0C851(Tdark)
UniProt: P0C851
Position
17p12
AA seq 137 aa
MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMS
VGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKH
RQKSNFLRSLKSFFLTR
NT seq 414 nt   +upstreamnt  +downstreamnt
atgacgatggagactctccccaaggttctagaggtcgatgagaagtctccagaagccaag
gacctgctgcccagccagaccgccagctccctgtgcatcagctccaggagcgagtctgtc
tggaccaccacccccaggagtaactgggaaatctaccgcaagcccatcgttatcatgtca
gtgggcggtgccatcctgcttttcggcgtggtcatcacctgcttggcctacaccttgaag
ctgagtgacaagagtctctccatcctcaaaatggtagggcctggcttcctgtccctggga
ctcatgatgctggtgtgcgggctggtgtgggtgcccatcatcaaaaagaaacagaagcac
agacagaagtcgaatttcttacgcagcctcaagtccttcttcctgactcgctga

DBGET integrated database retrieval system