KEGG   Homo sapiens (human): 644168
Entry
644168            CDS       T01001                                 

Gene name
DRGX, DRG11, PRRXL1
Definition
(RefSeq) dorsal root ganglia homeobox
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 644168
NCBI-ProteinID: NP_001263380
OMIM: 606701
HGNC: 21536
Ensembl: ENSG00000165606
Vega: OTTHUMG00000018192
Pharos: A6NNA5(Tbio)
UniProt: A6NNA5
Position
10q11.23
AA seq 263 aa
MFYFHCPPQLEGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDV
FTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSP
PPGDQARSKKEALEAQQSLGRTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLC
SCCVPDPMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKP
APPDGSQEKTSPTKEQSEAEKSV
NT seq 792 nt   +upstreamnt  +downstreamnt
atgttttatttccactgcccgccacagctagagggcactgcaacctttggcaatcactct
tcgggggattttgatgacgggtttctgcgtagaaaacagcgccggaaccggacgacgttc
actcttcagcagctggaagctctcgaggccgtttttgcccaaacacactatccagatgtc
ttcaccagagaagagctcgccatgaaaataaacctcacagaagccagagtgcaggtttgg
ttccagaacagaagggccaaatggaggaagacagagagaggggcctcagaccaggagcca
ggagccaaggagcccatggcagaggtgacacctcctccagtgagaaacatcaactccccg
ccccctggggaccaagcccggagtaagaaggaggcgctggaggcccagcagagcctgggg
cgaacggtaggtcctgcagggcctttcttcccctcctgcttgccggggactctcctgaac
acggccacctacgcccaggccttgtcccatgtggcttccctcaaagggggcccactgtgc
tcttgctgcgtcccagaccccatgggactctccttccttcccacctatggctgccagagt
aaccgcacggccagcgtggccaccctgcgcatgaaggcccgcgagcactcagaagctgtc
ctgcagtcagccaacctcctgccttccaccagcagcagccccggccctgtcgccaagccg
gcgcccccagatggcagccaggaaaagacctctcccaccaaggaacagagcgaggcagag
aagagtgtatga

DBGET integrated database retrieval system