KEGG   Homo sapiens (human): 64419Help
Entry
64419             CDS       T01001                                 

Gene name
MTMR14, C3orf29
Definition
(RefSeq) myotubularin related protein 14
  KO
K18086  myotubularin-related protein 14 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    64419 (MTMR14)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    64419 (MTMR14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64419 (MTMR14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    64419 (MTMR14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     64419 (MTMR14)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     64419 (MTMR14)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    64419 (MTMR14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 64419
NCBI-ProteinID: NP_001070993
OMIM: 611089
HGNC: 26190
Ensembl: ENSG00000163719
Vega: OTTHUMG00000155111
Pharos: Q8NCE2(Tbio)
UniProt: Q8NCE2
Position
3p25.3
AA seq 650 aa AA seqDB search
MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKR
CLELFGRDYCFSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRS
KMARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEE
DCALRSGDTHLFDKVRGYDIKLLRYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYA
DFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQC
WDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKP
TEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRK
SHSSSPQSVLWNRPQPSEDRLPSQQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSV
DHPLPGSSLSTDYGSWQMVTGCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETR
LQEVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgctcgggccgccgccgccgctgcctcggcggggtcctcggcctcttcaggc
aaccagccgcctcaggagctggggcttggggagctgctggaggagttctcccggactcag
taccgggccaaggatggcagcgggaccggcggctctaaggttgagcgcattgagaagaga
tgtctggagctgtttggccgagactactgtttcagcgtgattccaaacacgaatggggat
atctgtggccactatccccggcacatcgtgttcctggagtatgagagttctgagaaggag
aaagacacgtttgagagtaccgtacaggtgagcaagttgcaagacctcatccaccgcagc
aagatggcccggtgcagaggacggtttgtctgcccagtaatcctgttcaagggcaagcac
atttgcaggtcggccacactggctggatggggagagctgtatggacgctcaggctacaac
tattttttctcagggggtgcagatgatgcctgggcagatgtggaggacgtcacggaggag
gactgtgctcttcgaagtggtgacacgcatctttttgataaggtcagaggctatgacatc
aagctgcttcgatacctgtcagtcaaatacatctgtgacctgatggtggagaacaagaag
gtgaagtttggcatgaatgtaacctcctctgagaaggtggacaaagcccagcgctatgcc
gacttcactctcctctccatcccgtatccaggctgtgaatttttcaaggaatataaagat
cgggattacatggcagaagggctcatatttaactggaagcaggactacgttgatgcccca
ttgagcatccccgacttcctgactcactctctgaacattgactggagccagtatcagtgt
tgggatctggtgcaacaaacacaaaactacctgaagctgctgctttccttagttaacagt
gatgatgacagcgggctgctggtacactgtatctcaggctgggatcggacccccctcttc
atctccctcctgcgcctttccttgtgggctgatgggctcatccacacgtccctgaagccc
actgagatcctctacctcactgtggcctatgactggttcctcttcgggcacatgttggta
gatcggctcagcaaaggggaggagattttcttcttctgcttcaattttttgaagcatatt
acctccgaggagttctctgctctgaagacccagaggaggaagagtttgccagcccgggat
ggaggcttcaccctggaagacatctgcatgctgagacgaaaggaccgtggcagcaccacc
agccttggcagcgacttctccctggtcatggagagttccccaggagccactgggagcttc
acctatgaggccgtggagctggtcccagcaggagcgccaactcaggcagcttggaggaag
agccactcatcctctccacagagtgtcctctggaaccggccacaaccctcagaggaccgc
ttgccttcccagcaggggctggcggaagccaggtcttccagctcctcttcctcaaaccat
tctgataactttttcaggatgggtagcagtcccctggaggtccccaaacccagatcagtg
gaccatcccctgcccggatcctctctctccacagactatggcagctggcagatggtaacg
ggctgtggcagtattcaggagcgggctgtcctgcacacagactcctctctccctttcagc
ttcccggatgagctccctaacagttgtctgcttgcagccctgagtgatcgagagactcgg
ctgcaggaggtgcgctcagccttcttggctgcgtacagcagcacagtggggcttcgggca
gtagcccccagtccttccggtgccatcgggggcctgctggagcaatttgcccgtggtgtt
ggactccggagcatcagcagcaatgccttgtga

DBGET integrated database retrieval system