KEGG   Homo sapiens (human): 644591
Entry
644591            CDS       T01001                                 
Symbol
PPIAL4G, COAS-2
Name
(RefSeq) peptidylprolyl isomerase A like 4G
  KO
K12738  peptidylprolyl cis-trans isomerase A-like 4 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    644591 (PPIAL4G)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     644591 (PPIAL4G)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    644591 (PPIAL4G)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 644591
NCBI-ProteinID: NP_001116540
HGNC: 33996
Ensembl: ENSG00000236334
Vega: OTTHUMG00000013629
Pharos: P0DN37(Tdark)
UniProt: P0DN37
Position
1:complement(148482548..148483302)
AA seq 164 aa
MVNSVIFFDITVDGKPLGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGF
MCQGGDFTHPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF
NT seq 495 nt   +upstreamnt  +downstreamnt
atggtcaactccgtcatcttttttgacatcaccgtcgacggcaagcccttgggccgcatc
tccatcaaacagtttgcagacaagattccaaagacagcagaaaactttcgtgctctgagc
actggagagaaaggatttcgttataagggttcctgctttcacagaattattccagggttt
atgtgtcagggtggtgacttcacacaccctaatggcaccggtgacaagtccatctatggg
gagaaatttgatgatgagaacctcatccgaaagcatacaggttctggcatcttgtccatg
gcaaatgctggacccaacacaaatggttcccagtttttcatctgcactgccaagactgag
tggttggatggcaagcatgtggcctttggcaaggtgaaagaacgtgtgaatattgtggaa
gccatggagcactttgggtacaggaatagcaagaccagcaagaagatcaccattgctgac
tgtggacaattctaa

DBGET integrated database retrieval system