KEGG   Homo sapiens (human): 64506
Entry
64506             CDS       T01001                                 
Symbol
CPEB1, CPE-BP1, CPEB, CPEB-1, h-CPEB, hCPEB-1
Name
(RefSeq) cytoplasmic polyadenylation element binding protein 1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    64506 (CPEB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    64506 (CPEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    64506 (CPEB1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     64506 (CPEB1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     64506 (CPEB1)
   mRNA cycle factors
    P-body specific factors
     64506 (CPEB1)
SSDB
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 64506
NCBI-ProteinID: NP_085097
OMIM: 607342
HGNC: 21744
Ensembl: ENSG00000214575
Pharos: Q9BZB8(Tbio)
UniProt: Q9BZB8
Structure
Position
15:complement(82543201..82648795)
AA seq 561 aa
MAFPLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHD
HLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSA
QSSTHSVLSMLHNPLGNVLGKPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRS
SSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSLSGGGPRDPLKMGVGSRMDQEQAAL
AAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLP
PRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLV
FELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQR
LDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYL
KAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRH
SMEGLRHHSPLMRNQKNRDSS
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcgttcccgctggaagaagaagcaggaaggataaaagattgctgggacaaccaggaa
gcacctgctctctccacgtgtagtaatgccaatatctttcgaaggataaatgccatattg
gataattctctggatttcagtagagtctgcactacacctataaaccgaggaattcatgat
catttgccagacttccaggactctgaagaaacagttacaagcaggatgcttttcccaacc
tctgcgcaagaatcttcccgtggcctcccagatgcaaatgacttgtgccttggcctgcag
tccctcagtctgacaggctgggaccgaccctggagcacccaggactcagattcctcagcc
cagagcagcacacactcggtactgagcatgctccataacccactgggaaatgtcctagga
aaaccccccttgagcttcctgcctctggatccccttgggtctgacttggtggacaagttt
ccagcaccctcagttagaggatcacgcctggacacccggcccatcctggactctcgatct
agcagcccctctgactcagacaccagtggcttcagctctggatcagatcatctctcagat
ttgatttcaagccttcgcatttctccacctctgcccttcctgtctctgtcagggggtggt
cccagagaccctttaaagatgggggtagggtctcggatggaccaagagcaagctgctctt
gctgcagtcactccctccccaaccagtgcttcaaagagatggccaggagcttctgtgtgg
ccatcctgggacctcctcgaagctcccaaagaccccttcagcatagagagagaggccagg
ctgcaccgacaagctgcagctgtgaatgaagccacctgtacctggagtggccagcttcct
ccccggaactataagaaccccatctactcttgcaaggtgtttctaggaggtgttccttgg
gatattacagaagctggattagttaacaccttccgtgtttttggctctttgagtgtggag
tggcctggtaaggatggcaagcatccccggtgtcctcccaaagggtatgtgtatctggtc
ttcgaactagagaagtctgtccgatccttgcttcaggcttgctctcatgacccgctgagc
ccagatggcctgagtgaatattatttcaagatgtccagccgaaggatgcgctgcaaggag
gtgcaggtgatcccctgggtattagccgacagtaactttgtccggagcccatctcagagg
cttgaccccagcaggacggtgtttgtcggtgctctgcatggaatgctaaatgctgaggcc
ctggcagccatcttgaacgacctatttggtggagtggtgtatgccgggattgacacagat
aagcacaagtatcccattggttctggtcgtgtgactttcaataaccaacggagttacctg
aaagcagtcagcgctgcttttgtggagatcaaaaccaccaagttcacaaagaaggttcag
attgacccctacctagaagattctctgtgtcatatctgcagttctcagcctggtcctttc
ttctgtcgagatcaggtctgcttcaaatacttctgccggagctgctggcactggcggcac
agcatggagggcctgcgccaccacagccccctgatgcggaaccagaagaaccgagattcc
agctag

DBGET integrated database retrieval system