hsa:645073; : No such data.
hsa:26748; : No such data.
hsa:2579; : No such data.

KEGG   Homo sapiens (human): 100008586
Entry
100008586         CDS       T01001                                 

Gene name
GAGE12F, AL4, CT4.7, GAGE-7, GAGE-7B, GAGE-8, GAGE7, GAGE7B
Definition
(RefSeq) G antigen 12F
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GAGE
Other DBs
NCBI-GeneID: 100008586
NCBI-ProteinID: NP_001091875
OMIM: 300730
HGNC: 31906
Ensembl: ENSG00000236362
Vega: OTTHUMG00000024147
UniProt: O76087 P0CL80 P0CL81 P0CL82
Position
Xp11.23
AA seq 117 aa
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
DEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
NT seq 354 nt   +upstreamnt  +downstreamnt
atgagttggcgaggaagatcgacctattattggcctagaccaaggcgctatgtacagcct
cctgaaatgattgggcctatgcggcccgagcagttcagtgatgaagtggaaccagcaaca
cctgaagaaggggaaccagcaactcaacgtcaggatcctgcagctgctcaggagggagag
gatgagggagcatctgcaggtcaagggccgaagcctgaagctcatagccaggaacagggt
cacccacagactgggtgtgagtgtgaagatggtcctgatgggcaggagatggacccgcca
aatccagaggaggtgaaaacgcctgaagaaggtgaaaagcaatcacagtgttaa

DBGET integrated database retrieval system