KEGG   Homo sapiens (human): 6451
Entry
6451              CDS       T01001                                 

Gene name
SH3BGRL, HEL-S-115, SH3BGR
Definition
(RefSeq) SH3 domain binding glutamate rich protein like
  KO
K23740   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SH3BGR Glutaredoxin
Other DBs
NCBI-GeneID: 6451
NCBI-ProteinID: NP_003013
OMIM: 300190
HGNC: 10823
Ensembl: ENSG00000131171
Vega: OTTHUMG00000021910
Pharos: O75368(Tbio)
UniProt: O75368 V9HW48
Structure
PDB: 
1U6T 1WRY

Position
Xq21.1
AA seq 114 aa
MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPA
TGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
NT seq 345 nt   +upstreamnt  +downstreamnt
atggtgatccgtgtatatattgcatcttcctctggctctacagcgattaagaagaaacaa
caagatgtgcttggtttcctagaagccaacaaaataggatttgaagaaaaagatattgca
gccaatgaagagaatcggaagtggatgagagaaaatgtacctgaaaatagtcgaccagcc
acaggttaccccctgccacctcagattttcaatgaaagccagtatcgcggggactatgat
gccttctttgaagccagagaaaataatgcagtgtatgccttcttaggcttgacagcccca
cctggttcaaaggaagcagaagtgcaagcaaagcagcaagcatga

DBGET integrated database retrieval system