KEGG   Homo sapiens (human): 6453Help
Entry
6453              CDS       T01001                                 

Gene name
ITSN1, ITSN, SH3D1A, SH3P17
Definition
(RefSeq) intersectin 1
  KO
K20045  intersectin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6453 (ITSN1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    6453 (ITSN1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    6453 (ITSN1)
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    6453 (ITSN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_13 SH3_9 SH3_1 SH3_2 INTAP RhoGEF EF-hand_4 C2 EF-hand_1 EF-hand_6 EF-hand_7 PH EF-hand_5 GSH_synthase
Motif
Other DBs
NCBI-GeneID: 6453
NCBI-ProteinID: NP_003015
OMIM: 602442
HGNC: 6183
Ensembl: ENSG00000205726
Vega: OTTHUMG00000065284
Pharos: Q15811(Tbio)
UniProt: Q15811 Q6PD56
Structure
PDB: 

Position
21q22.11
AA seq 1721 aa AA seqDB search
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGI
ASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQW
LEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAV
QAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTG
EPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS
SEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATG
SSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGW
FPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGD
LTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQ
VIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGT
SKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQ
VGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVT
EIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILS
AQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQ
RVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHV
QCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSG
TDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERT
AWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPY
CEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEI
RVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
NT seq 5166 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtttccaacaccttttggtggcagcctggatatctgggccataactgtagag
gaaagagcgaagcatgatcagcagttccatagtttaaagccaatatctggattcattact
ggtgatcaagctagaaactttttttttcaatctgggttacctcaacctgttttagcacag
atatgggcactagctgacatgaataatgatggaagaatggatcaagtggagttttccata
gctatgaaacttatcaaactgaagctacaaggatatcagctaccctctgcacttccccct
gtcatgaaacagcaaccagttgctatttctagcgcaccagcatttggtatgggaggtatc
gccagcatgccaccgcttacagctgttgctccagtgccaatgggatccattccagttgtt
ggaatgtctccaaccctagtatcttctgttcccacagcagctgtgccccccctggctaac
ggggctccccctgttatacaacctctgcctgcatttgctcatcctgcagccacattgcca
aagagttcttcctttagtagatctggtccagggtcacaactaaacactaaattacaaaag
gcacagtcatttgatgtggccagtgtcccaccagtggcagagtgggctgttcctcagtca
tcaagactgaaatacaggcaattattcaatagtcatgacaaaactatgagtggacactta
acaggtccccaagcaagaactattcttatgcagtcaagtttaccacaggctcagctggct
tcaatatggaatctttctgacattgatcaagatggaaaacttacagcagaggaatttatc
ctggcaatgcacctcattgatgtagctatgtctggccaaccactgccacctgtcctgcct
ccagaatacattccaccttcttttagaagagttcgatctggcagtggtatatctgtcata
agctcaacatctgtagatcagaggctaccagaggaaccagttttagaagatgaacaacaa
caattagaaaagaaattacctgtaacgtttgaagataagaagcgggagaactttgaacgt
ggcaacctggaactggagaaacgaaggcaagctctcctggaacagcagcgcaaggagcag
gagcgcctggcccagctggagcgggcggagcaggagaggaaggagcgtgagcgccaggag
caagagcgcaaaagacaactggaactggagaagcaactggaaaagcagcgggagctagaa
cggcagagagaggaggagaggaggaaagaaattgagaggcgagaggctgcaaaacgggaa
cttgaaaggcaacgacaacttgagtgggaacggaatcgaaggcaagaactactaaatcaa
agaaacaaagaacaagaggacatagttgtactgaaagcaaagaaaaagactttggaattt
gaattagaagctctaaatgataaaaagcatcaactagaagggaaacttcaagatatcaga
tgtcgattgaccacccaaaggcaagaaattgagagcacaaacaaatctagagagttgaga
attgccgaaatcacccatctacagcaacaattacaggaatctcagcaaatgcttggaaga
cttattccagaaaaacagatactcaatgaccaattaaaacaagttcagcagaacagtttg
cacagagattcacttgttacacttaaaagagccttagaagcaaaagaactagctcggcag
cacctacgagaccaactggatgaagtggagaaagaaactagatcaaaactacaggagatt
gatattttcaataatcagctgaaggaactaagagaaatacacaataagcaacaactccag
aagcaaaagtccatggaggctgaacgactgaaacagaaagaacaagaacgaaagatcata
gaattagaaaaacaaaaagaagaagcccaaagacgagctcaggaaagggacaagcagtgg
ctggagcatgtgcagcaggaggacgagcatcagagaccaagaaaactccacgaagaggaa
aaactgaaaagggaggagagtgtcaaaaagaaggatggcgaggaaaaaggcaaacaggaa
gcacaagacaagctgggtcggcttttccatcaacaccaagaaccagctaagccagctgtc
caggcaccctggtccactgcagaaaaaggtccacttaccatttctgcacaggaaaatgta
aaagtggtgtattaccgggcactgtacccctttgaatccagaagccatgatgaaatcact
atccagccaggagacatagtcatggttaaaggggaatgggtggatgaaagccaaactgga
gaacccggctggcttggaggagaattaaaaggaaagacagggtggttccctgcaaactat
gcagagaaaatcccagaaaatgaggttcccgctccagtgaaaccagtgactgattcaaca
tctgcccctgcccccaaactggccttgcgtgagacccccgcccctttggcagtaacctct
tcagagccctccacgacccctaataactgggccgacttcagctccacgtggcccaccagc
acgaatgagaaaccagaaacggataactgggatgcatgggcagcccagccctctctcacc
gttccaagtgccggccagttaaggcagaggtccgcctttactccagccacggccactggc
tcctccccgtctcctgtgctaggccagggtgaaaaggtggaggggctacaagctcaagcc
ctatatccttggagagccaaaaaagacaaccacttaaattttaacaaaaatgatgtcatc
accgtcctggaacagcaagacatgtggtggtttggagaagttcaaggtcagaagggttgg
ttccccaagtcttacgtgaaactcatttcagggcccataaggaagtctacaagcatggat
tctggttcttcagagagtcctgctagtctaaagcgagtagcctctccagcagccaagccg
gtcgtttcgggagaagaatttattgccatgtacacttacgagagttctgagcaaggagat
ttaacctttcagcaaggggatgtgattttggttaccaagaaagatggtgactggtggaca
ggaacagtgggcgacaaggccggagtcttcccttctaactatgtgaggcttaaagattca
gagggctctggaactgctgggaaaacagggagtttaggaaaaaaacctgaaattgcccag
gttattgcctcatacaccgccaccggccccgagcagctcactctcgcccctggtcagctg
attttgatccgaaaaaagaacccaggtggatggtgggaaggagagctgcaagcacgtggg
aaaaagcgccagataggctggttcccagctaattatgtaaagcttctaagccctgggacg
agcaaaatcactccaacagagccacctaagtcaacagcattagcggcagtgtgccaggtg
attgggatgtacgactacaccgcgcagaatgacgatgagctggccttcaacaagggccag
atcatcaacgtcctcaacaaggaggaccctgactggtggaaaggagaagtcaatggacaa
gtggggctcttcccatccaattatgtgaagctgaccacagacatggacccaagccagcaa
tggtgttcagacttacatctcttggatatgttgaccccaactgaaagaaagcgacaagga
tacatccacgagctcattgtcaccgaggagaactatgtgaatgacctgcagctggtcaca
gagatttttcaaaaacccctgatggagtctgagctgctgacagaaaaagaggttgctatg
atttttgtgaactggaaggagctgattatgtgtaatatcaaactactaaaagcgctgaga
gtccgcaagaagatgtccggggagaagatgcctgtgaagatgattggagacatcctgagc
gcacagctgccgcacatgcagccctacatccgcttctgcagccgccagctcaacggggct
gccctgatccagcagaagacggatgaggccccagacttcaaggagttcgtcaaaagattg
gcaatggatcctcggtgtaaagggatgccactctctagttttatactgaagcctatgcaa
cgggtaacaagatacccactgatcattaaaaatatcctggaaaacacccctgaaaaccac
ccggaccacagccacttgaagcacgccctggagaaggcggaagagctctgttcccaggtg
aacgaaggggtgcgggagaaggagaactctgaccggctggagtggatccaggcccacgtg
cagtgtgaaggcctgtctgagcaacttgtgttcaattcagtgaccaattgcttggggccg
cgcaaatttctgcacagtgggaagctctacaaggccaagagcaacaaggagctgtatggc
ttccttttcaacgacttcctcctgctgactcagatcacgaagcctttggggtcttctggc
accgacaaagtcttcagccccaaatcaaacctgcagtataaaatgtataaaacacctatt
ttcctaaatgaggttctagtaaaattacccaccgacccttctggagacgagcccatcttc
cacatctcccacattgaccgcgtctatactctccgagcagaaagcataaatgaaaggact
gcctgggtgcagaaaatcaaagctgcttctgaactctacatagagactgagaaaaagaag
cgcgagaaagcgtacctggtccgttcccaaagggcaacaggcattggaaggttgatggtg
aacgtggttgaaggcatcgagttgaaaccctgtcggtcacatggaaagagcaacccgtac
tgtgaggtgaccatgggttcccagtgccacatcaccaagacgatccaggacactctgaac
cccaagtggaattccaactgccagttcttcatccgagacctggagcaggaagtcctctgc
atcactgtgttcgagagggaccagttctcaccagatgattttttgggtcggacggagatc
cgtgtggcggacatcaagaaagaccagggctccaaaggtccagttacgaagtgtcttctg
ctgcacgaagtccccacgggagagattgtggtccgcttggacctgcagttgtttgatgag
ccgtag

DBGET integrated database retrieval system