KEGG   Homo sapiens (human): 645359Help
Entry
645359            CDS       T01001                                 

Gene name
PRAMEF26, PRAMEF25
Definition
(RefSeq) PRAME family member 26
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 645359
NCBI-ProteinID: NP_001293001
HGNC: 49178
Ensembl: ENSG00000280267
Vega: OTTHUMG00000009499
Pharos: A6NGN4(Tdark)
UniProt: A6NGN4
Position
1p36.21
AA seq 478 aa AA seqDB search
MKMSIRTPPRLLELAGRSVLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQA
WPFRRLPLRPLIKMPCLETFQAVLNGLDALLTHGVRPRRWKLQVLDLQDVCENFWMVWSE
AMARGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEHLTCLLLWVKQRKDLL
HLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLV
LSHMDVSRYVSPEQKKEIVTQFTTQFLKLHCLQKLYMNSVSFLEGHLDQLLSCLKTSLKV
LTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLD
DCGIIDSQVNAILPALSRCFELNTFSFCGNPISMATLENLLSHTIILKNLCLELYPAPRE
SYGADGTLCWSRFTQIRAELMKRVRDLRHPKRILFGTDYCPDCGNRSFYDLEADQYCC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagcatccggactccacccagactcctggagctggcggggcggagcgtgctg
agggaccaagccttggccatgtccaccctggaggagctgcccacagaacttttcccccca
ctgttcatggaggccttcagcaggagacgctgtgaggccctgaagctgatggtacaggcc
tggcccttccgccgcctccctctgaggcctctgataaagatgccttgtctggagaccttc
caagctgtgctcaatgggcttgatgcactgcttacccacggggttcgtcccaggaggtgg
aaacttcaagtgctggatttacaggatgtctgtgagaacttctggatggtttggtctgaa
gctatggcccgtgggtgcttcctcaatgccaagaggaacaaaaaaccagtgcaggactgt
ccaaggatgagaggacggcagcccttgactgtgttcgtagaactttggctcaagaacagg
actctggatgaacacctcacctgcctccttctatgggtcaagcagaggaaagatttacta
cacctgtgctgtaagaagctgaaaattttgggaatgcccttccgcaatatcagaagcatc
ctgaaaatggtgaacctagactgtatccaggaggtggaagtgaattgcaagtgggtactg
cccatcctgacacagtttaccccatacctgggccacatgaggaatcttcagaagctcgtt
ctctcccacatggatgtctctcgctacgtttccccagagcagaagaaggagattgttacc
cagttcaccactcagttcctcaagctgcactgcctccaaaagctttatatgaactctgtt
tctttcctcgaaggccacctggaccagctgctcagctgtctgaagacctcgttaaaggtc
ctcacaataactaactgtgtgcttttggaatcagacttgaagcatctatcccagtgcccg
agtatcagtcaactaaagaccctggacctgagtggcatcagactgaccaattacagtctt
gtgcctctccaaattctcctagaaaaagttgcagccacccttgagtacctggatttagat
gactgtggcatcatagactcccaagtcaacgccatcctgcctgccctgagccgctgcttt
gagctcaacaccttcagcttctgtggaaatcccatctccatggccaccctggagaacctg
ctgagccacacaatcatactcaaaaacttatgcctggagctgtatcctgccccacgggag
agttatggtgctgatggtactctctgctggagcagatttactcagattagggctgagctg
atgaagagagttagggacttaaggcaccccaagaggatcttgttcggtactgactactgc
cctgactgtggcaacaggtcattttatgacctggaggcagatcaatactgctgttga

DBGET integrated database retrieval system