KEGG   Homo sapiens (human): 645402Help
Entry
645402            CDS       T01001                                 

Gene name
USP17L4
Definition
(RefSeq) ubiquitin specific peptidase 17-like family member 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 HABP4_PAI-RBP1
Motif
Other DBs
NCBI-GeneID: 645402
NCBI-ProteinID: NP_001243803
HGNC: 37176
Ensembl: ENSG00000236125
Vega: OTTHUMG00000150574
Pharos: A6NCW7(Tdark)
UniProt: A6NCW7
Position
8p23.1
AA seq 530 aa AA seqDB search
MGDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSSETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYENASLQCLTYTLPLANYMLSREHSQTCQRP
KCCMLCTMQAHITWALHSPGHVIQPSQALAAGFHRGKQEDVHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGCWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVKQALEQL
VKPEELNGENAYHCGLCLQRAPASNTLTLHTSAKVLILVLKRFSDVAGNKLAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHDGYYFSYVKAQEGQWYKMDDAEVTVCSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRPATQGELKRDHPCLQVPEL
DEHLVERATEESTLDHWKFPQEQNKMKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHP
EQQSSLLNLSSMNSTDQESMNTGTLASLQGRTRRSKGKNKHSKRSLLVCQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgactcactctacttgggaggtgagtggcagttcaaccacttttcaaaactc
acatcttctcggccagatgcagcttttgctgaaatccagcggacttctctccctgagaag
tcaccactctcatctgagacccgtgtcgacctctgtgatgatttggctcctgtggcaaga
cagctcgctcccagggagaagcttcctctgagtagcaggagacctgctgcggtgggggct
gggctccagaatatgggaaatacctgctacgagaacgcttccctgcagtgcctgacatac
acactgccccttgccaactacatgctgtcccgggagcactctcaaacatgtcagcgtccc
aagtgctgcatgctctgtactatgcaagctcacatcacatgggccctccacagtcctggc
catgtcatccagccctcacaggcattggctgctggcttccatagaggcaagcaggaagat
gtccatgaatttctcatgttcactgtggatgccatgaaaaaggcatgccttcccggccac
aagcaggtagatcatcactctaaggacaccaccctcatccaccaaatatttggaggctgc
tggagatctcaaatcaagtgtctccactgccacgggatttcagacacttttgacccttac
ctggacatcgccctggatatccaggcagctcagagtgtcaagcaagctttggaacagttg
gtgaagcccgaagaactcaatggagagaatgcctatcattgcggtctttgtctccagagg
gcgccggcctccaacacgttaactttacacacttctgccaaggtcctcatccttgtcttg
aagagattctccgatgtcgcaggcaacaaacttgccaagaatgtgcaatatcctgagtgc
cttgacatgcagccatacatgtctcagcagaacacaggacctcttgtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacgacggatattacttctcttatgtcaaa
gctcaagaaggccagtggtataaaatggatgatgccgaggtcactgtctgtagcatcact
tctgtcctgagtcaacaggcctatgtcctcttttacatccagaagagtgaatgggaaaga
cacagtgagagtgtgtcaagaggcagggaaccaagagcccttggcgctgaagacacagac
aggccagcaacgcaaggagagctcaagagagaccacccttgcctccaggtacccgagttg
gacgagcacttggtggaaagagccactgaggaaagcaccttagaccactggaaattcccc
caagagcaaaacaaaatgaagcctgagttcaacgtcagaaaagttgaaggtaccctgcct
cccaacgtacttgtgattcatcaatcaaaatacaagtgtgggatgaaaaaccaccatcct
gaacagcaaagctccctgctaaacctctcttcgatgaactcgacagatcaggagtccatg
aacactggcacactcgcttctctgcaagggaggaccaggagatccaaagggaagaacaaa
cacagcaagagatctctgcttgtgtgccagtga

DBGET integrated database retrieval system