KEGG   Homo sapiens (human): 6455
Entry
6455              CDS       T01001                                 

Gene name
SH3GL1, CNSA1, EEN, SH3D2B, SH3P8
Definition
(RefSeq) SH3 domain containing GRB2 like 1, endophilin A2
  KO
K11247  endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6455 (SH3GL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6455 (SH3GL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    6455 (SH3GL1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    6455 (SH3GL1)
SSDB
Motif
Pfam: BAR SH3_1 SH3_9 BAR_2 SH3_2 BAR_3 Prefoldin_3 PhnG Exonuc_VII_L DUF2570
Other DBs
NCBI-GeneID: 6455
NCBI-ProteinID: NP_003016
OMIM: 601768
HGNC: 10830
Ensembl: ENSG00000141985
Vega: OTTHUMG00000181918
Pharos: Q99961(Tbio)
UniProt: Q99961 Q6FGM0
Position
19p13.3
AA seq 368 aa
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKL
KRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPS
RSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYV
EVLVPLPQ
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtcggtggcggggctgaagaagcagttctacaaggcgagccagctggtcagtgagaag
gtcggaggggccgaggggaccaagctggatgatgacttcaaagagatggagaagaaggtg
gatgtcaccagcaaggcggtgacagaagtgctggccaggaccatcgagtacctgcagccc
aacccagcctcgcgggctaagctgaccatgctcaacacggtgtccaagatccggggccag
gtgaagaaccccggctacccgcagtcggaggggcttctgggcgagtgcatgatccgccac
gggaaggagctgggcggcgagtccaactttggtgacgcattgctggatgccggcgagtcc
atgaagcgcctggcagaggtgaaggactccctggacatcgaggtcaagcagaacttcatt
gaccccctccagaacctgtgcgagaaagacctgaaggagatccagcaccacctgaagaaa
ctggagggccgccgcctggactttgactacaagaagaagcggcagggcaagatccccgat
gaggagctacgccaggcgctggagaagttcgaggagtccaaggaggtggcagaaaccagc
atgcacaacctcctggagactgacatcgagcaggtgagtcagctctcggccctggtggat
gcacagctggactaccaccggcaggccgtgcagatcctggacgagctggcggagaagctc
aagcgcaggatgcgggaagcttcctcacgccctaagcgggagtataagcccaagccccgg
gagccctttgaccttggagagcctgagcagtccaacgggggcttcccctgcaccacagcc
cccaagatcgcagcttcatcgtctttccgatcttccgacaagcccatccggacccctagc
cggagcatgccgcccctggaccagccgagctgcaaggcgctgtacgacttcgagcccgag
aacgacggggagctgggcttccatgagggcgacgtcatcacgctgaccaaccagatcgat
gagaactggtacgagggcatgctggacggccagtcgggcttcttcccgctcagctacgtg
gaggtgcttgtgcccctgccgcagtga

DBGET integrated database retrieval system