KEGG   Homo sapiens (human): 6456Help
Entry
6456              CDS       T01001                                 

Gene name
SH3GL2, CNSA2, EEN-B1, SH3D2A, SH3P4
Definition
(RefSeq) SH3 domain containing GRB2 like 2, endophilin A1
  KO
K11247  endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6456 (SH3GL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6456 (SH3GL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    6456 (SH3GL2)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    6456 (SH3GL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_2 SH3_1 SH3_9 BAR_2 BAR_3 DNA_pol_B_2
Motif
Other DBs
NCBI-GeneID: 6456
NCBI-ProteinID: NP_003017
OMIM: 604465
HGNC: 10831
Ensembl: ENSG00000107295
Vega: OTTHUMG00000019601
Pharos: Q99962(Tbio)
UniProt: Q99962 Q7Z376
Structure
PDB: 

Position
9p22.2
AA seq 352 aa AA seqDB search
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggccggcctcaagaagcagttccataaagccactcagaaagtgagtgagaag
gttggaggagctgaaggaaccaagctagatgatgacttcaaagagatggaaaggaaagtg
gatgtcaccagcagggctgtgatggaaataatgactaaaacaattgaataccttcaaccc
aatccagcttccagagctaagctcagcatgatcaacaccatgtcaaaaatccgtggccag
gagaaggggccaggctatcctcaggcagaggcgctgctggcagaggccatgctcaaattt
ggaagagagcttggagatgattgcaactttggcccagcacttggtgaggtcggggaggcc
atgcgggaactgtcggaggtcaaagactctttggacatagaagtgaagcagaacttcatt
gaccctcttcagaatcttcatgacaaagatcttagggaaattcaacatcatctaaagaag
ttggagggtcgacgcctggattttgattataagaagaaacgacaaggcaagattccggat
gaagagcttcgtcaagctctagagaaatttgatgagtctaaggaaattgctgagtcaagc
atgttcaatctcttggagatggatattgaacaagtgagccagctctctgcacttgtgcaa
gctcagctggagtaccacaagcaggcagtccagatcctgcagcaagtcacggtcagactg
gaagaaagaataagacaggcttcatctcagcctagaagggaatatcaacctaaaccacga
atgagcctggagtttccaactggagacagtactcagcccaatgggggtctctcccacaca
ggcactcccaaaccttcaggtgtccaaatggatcagccctgctgccgagctctgtacgac
tttgaacctgaaaatgaaggggagttgggatttaaagagggcgatatcatcacactcact
aaccaaattgatgagaactggtatgaggggatgctgcatggccattcaggcttcttcccc
atcaattatgtggaaattctggttgccctgccccattag

DBGET integrated database retrieval system