KEGG   Homo sapiens (human): 64581Help
Entry
64581             CDS       T01001                                 

Gene name
CLEC7A, BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2
Definition
(RefSeq) C-type lectin domain containing 7A
  KO
K10074  C-type lectin domain family 7 member A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04625  C-type lectin receptor signaling pathway
hsa05152  Tuberculosis
Disease
H01109  Chronic mucocutaneous candidiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    64581 (CLEC7A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    64581 (CLEC7A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    64581 (CLEC7A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64581 (CLEC7A)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    64581 (CLEC7A)
   04090 CD molecules [BR:hsa04090]
    64581 (CLEC7A)
   04091 Lectins [BR:hsa04091]
    64581 (CLEC7A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    64581 (CLEC7A)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   64581 (CLEC7A)
CD molecules [BR:hsa04090]
 Proteins
  64581 (CLEC7A)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   64581 (CLEC7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Ly49 UL45 Claudin_2 Chordopox_A33R
Motif
Other DBs
NCBI-GeneID: 64581
NCBI-ProteinID: NP_922938
OMIM: 606264
HGNC: 14558
Ensembl: ENSG00000172243
Vega: OTTHUMG00000133597
Pharos: Q9BXN2(Tbio)
UniProt: Q9BXN2 Q68D78 A0A024RAN9
Position
12p13.2
AA seq 247 aa AA seqDB search
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPC
PPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFW
IGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
CEKKFSM
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcatcctgatttagaaaatttggatgaagatggatatactcaattacacttc
gactctcaaagcaataccaggatagctgttgtttcagagaaaggatcgtgtgctgcatct
cctccttggcgcctcattgctgtaattttgggaatcctatgcttggtaatactggtgata
gctgtggtcctgggtaccatggctatttggagatccaattcaggaagcaacacattggag
aatggctactttctatcaagaaataaagagaaccacagtcaacccacacaatcatcttta
gaagacagtgtgactcctaccaaagctgtcaaaaccacaggggttctttccagcccttgt
cctcctaattggattatatatgagaagagctgttatctattcagcatgtcactaaattcc
tgggatggaagtaaaagacaatgctggcaactgggctctaatctcctaaagatagacagc
tcaaatgaattgggatttatagtaaaacaagtgtcttcccaacctgataattcattttgg
ataggcctttctcggccccagactgaggtaccatggctctgggaggatggatcaacattc
tcttctaacttatttcagatcagaaccacagctacccaagaaaacccatctccaaattgt
gtatggattcacgtgtcagtcatttatgaccaactgtgtagtgtgccctcatatagtatt
tgtgagaagaagttttcaatgtaa

DBGET integrated database retrieval system