KEGG   Homo sapiens (human): 645811
Entry
645811            CDS       T01001                                 

Gene name
CCDC154, C16orf29
Definition
(RefSeq) coiled-coil domain containing 154
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCDC154
Other DBs
NCBI-GeneID: 645811
NCBI-ProteinID: NP_001137452
OMIM: 618740
HGNC: 34454
Ensembl: ENSG00000197599
Pharos: A6NI56(Tdark)
UniProt: A6NI56
Position
16p13.3
AA seq 667 aa
MSELADSGPSGASAPSQLRAVTLEDLGLLLAGGLASPEPLSLEELSERYESSHPTSTASV
PEQDTAKHWNQLEQWVVELQAEVACLREHKQRCERATRSLLRELLQVRARVQLQGSELRQ
LQQEARPAAQAPEKEAPEFSGLQNQMQALDKRLVEVREALTRLRRRQVQQEAERRGAEQE
AGLRLAKLTDLLQQEEQGREVACGALQKNQEDSSRRVDLEVARMQAQVTKLGEEVSLRFL
KREAKLCGFLQKSFLALEKRMKASESSRLKLEGSLRGELESRWEKLRGLMEERLRALQGQ
HEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGELAAYV
QENLEAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLPALSSRLDLQ
EQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLL
HKSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATFQNQI
MKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVR
PRVFIKDMAPGKVVPMNCWGVYQAVRWLRWKASLIKLRALRRPGGVLEKPHSQEQVQQLT
PSLFIQK
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgtcagagttggctgacagtggaccctcaggggcatcggccccttcccagctgagagcc
gtcaccctggaagacctggggctcctcctggcaggaggcctggccagccccgagcccttg
agcctggaggagctctcggagaggtatgagtccagccatccgacatccacggcctctgtc
cccgagcaggacaccgccaagcactggaaccagctggagcagtgggtggtggagctgcag
gccgaggtggcctgcctgcgggagcacaagcagcgctgtgagcgcgccacgcggagcctg
ctgcgggagctgctccaggtgcgggcccgcgtgcagctgcagggctcagagctgaggcag
ttgcagcaggaggcgcggccggcagcccaggcccccgaaaaggaggcgccggagttctct
ggtctccagaaccagatgcaggccctggacaaaaggctggtggaggtccgggaagccttg
acccggctcaggaggaggcaggtgcaacaggaggcggagagaaggggcgccgagcaagag
gccggcctcagactggccaagctgaccgacttgctgcagcaggaggagcagggccgggag
gtggcctgcggcgccctgcagaagaaccaagaggacagcagccggagggtggacctggag
gtggccagaatgcaggcccaggtgaccaagctcggcgaagaggtgagcctgcgcttcctg
aagagggaggccaagctgtgcggcttcctgcagaagagcttcctggccctggagaagaga
atgaaggcctcggagagctcacggctgaagctggagggcagcctgcggggcgagctggag
agccggtgggagaagcttcgggggctgatggaggagcgcctgcgggccctgcaggggcag
catgaggagagccacctcctggagcagtgccagggcctggatgctgccgtggcccagctg
accaagtttgtgcagcagaaccaggcgtcgctgaaccgtgtcctactggccgaggagaaa
gcctgggacgccaaggggcgcttggaggaaagccgggctggggagctggccgcctatgtg
caggagaacctggaggccgcacagctggctggcgagctggcccggcaggagatgcatgga
gagctggtgctgctccgagagaagagccgggctctggaggcatccgtggcgcagctggcc
gggcagttaaaggagctgagtggccatctcccggctctgagcagccggctcgatctgcag
gagcagatgctgggcctcaggctgtccgaggcaaagaccgaatgggaaggtgcagagagg
aagtccctggaggacctggccaggtggcggaaggaggtgaccgaacacctgcgaggggtg
cgggagaaggtggatggcctcccccagcagatagagagtgtctccgacaagtgcctgctt
cataagagcgactcagacctcaggatttccgccgaaggcaaggccagggagttcaaggtt
ggggccctgcggcaggagctggccacgctactatcatccgtgcagctgctaaaggaagac
aaccctgggcggaagatcgcggagatgcagggcaagctggccacgtttcagaaccaaata
atgaagctggaaaactgcgtccaggccaacaagaccatccagaacctcaggttcaacact
gaggcccggctgcgcacgcaggagatggccaccctgtgggagagtgtgctccggctgtgg
agtgaggagggcccgcggacgccgctgggcagctggaaggcgctcccatccctggtgagg
ccgcgggtcttcatcaaggacatggcgcctggcaaggtggtgcccatgaactgctggggc
gtgtaccaggctgtgaggtggctgcgctggaaggcgtccctcataaagctcagggccctg
cggaggccaggaggggtcctggagaagccccacagccaggagcaggtgcagcagctcaca
ccctcactgtttatccagaaataa

DBGET integrated database retrieval system