KEGG   Homo sapiens (human): 64582
Entry
64582             CDS       T01001                                 

Gene name
GPR135, HUMNPIIY20
Definition
(RefSeq) G protein-coupled receptor 135
  KO
K08427  G protein-coupled receptor 135
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    64582 (GPR135)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    64582 (GPR135)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 64582
NCBI-ProteinID: NP_072093
OMIM: 607970
HGNC: 19991
Ensembl: ENSG00000181619
Vega: OTTHUMG00000140325
Pharos: Q8IZ08(Tbio)
UniProt: Q8IZ08
Position
14q23.1
AA seq 494 aa
MEEPQPPRPPASMALLGSQHSGAPSAAGPPGGTSSAATAAVLSFSTVATAALGNLSDASG
GGTAAAPGGGGLGGSGAAREAGAAVRRPLGPEAAPLLSHGAAVAAQALVLLLIFLLSSLG
NCAVMGVIVKHRQLRTVTNAFILSLSLSDLLTALLCLPAAFLDLFTPPGGSAPAAAAGPW
RGFCAASRFFSSCFGIVSTLSVALISLDRYCAIVRPPREKIGRRRALQLLAGAWLTALGF
SLPWELLGAPRELAAAQSFHGCLYRTSPDPAQLGAAFSVGLVVACYLLPFLLMCFCHYHI
CKTVRLSDVRVRPVNTYARVLRFFSEVRTATTVLIMIVFVICCWGPYCFLVLLAAARQAQ
TMQAPSLLSVVAVWLTWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQGP
GLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTA
VTKQPKSEAGDTSL
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggaggagccgcagccgccccgcccaccagcgagcatggccttactgggcagccagcac
tccggcgccccctccgcggccggcccacctggcgggacttcctccgcggccacggcggcc
gtgctctccttcagcaccgtggcgaccgcggcgctggggaacctgagcgacgcaagcgga
ggcggcacagctgccgctcccggtggcggcggccttggcgggtccggggcagcgcgggag
gcgggggcggcggtgaggcggccgctaggcccggaggcggcgccgctgctgtcgcacgga
gctgcagtggcggcccaggcgctcgtcctcctgctcatcttcctgctgtctagccttggc
aactgcgcggtgatgggggtgattgtgaagcaccggcagctccgcaccgtcaccaacgcc
ttcatcctgtcgctgtccctatcggatctgctcacggcgctgctctgcctgcccgccgcc
ttcctggacctcttcactccgcccgggggttcggcgcctgccgccgccgcggggccctgg
cgcggcttctgcgccgccagccgcttcttcagctcgtgcttcggcatcgtgtccacgctc
agcgtggcgctcatctcgttggaccgttactgcgctatcgtgcggccgccgcgggagaag
atcggccgccgccgcgcgctgcagctgctggcgggcgcctggctgacggccctgggcttc
tccttgccctgggagctgctcggggcgccccgggaactcgcggcggcgcagagcttccac
ggctgcctctaccggacctccccggaccccgcgcagctgggcgcggccttcagcgtgggg
ctggtggtggcctgctacctgctgcccttcctgctcatgtgcttctgccactaccacatc
tgcaagacggtgcgcctgtcggacgtgcgcgtgcggccggtgaacacctacgcgcgcgtg
ctgcgcttcttcagcgaggtgcgcacggccaccaccgtcctcatcatgatcgtcttcgtc
atctgctgctgggggccctactgcttcctggtgctgctggccgccgcccggcaggcccag
accatgcaggccccctcgctcctcagcgtggtggccgtctggctgacctgggccaatggg
gccatcaaccctgtcatctacgccatccgcaatcccaacatttcgatgctcctagggcgc
aaccgcgaggagggctaccggactaggaatgtggacgctttcctgcccagccagggcccg
ggtctgcaagccagaagccgcagtcgccttcgaaaccgctatgccaaccggctgggggcc
tgcaacaggatgtcctcttccaacccggccagcggagtggcaggggacgtggccatgtgg
gcccgcaaaaatccagttgtacttttctgccgagagggaccaccagagccggtgacggca
gtgaccaaacagcctaaatccgaagctggggataccagcctctaa

DBGET integrated database retrieval system