KEGG   Homo sapiens (human): 64600Help
Entry
64600             CDS       T01001                                 

Gene name
PLA2G2F, GIIFsPLA2, sPLA2-IIF
Definition
(RefSeq) phospholipase A2 group IIF
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283 D08107 D08221
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    64600 (PLA2G2F)
   00565 Ether lipid metabolism
    64600 (PLA2G2F)
   00590 Arachidonic acid metabolism
    64600 (PLA2G2F)
   00591 Linoleic acid metabolism
    64600 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    64600 (PLA2G2F)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    64600 (PLA2G2F)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    64600 (PLA2G2F)
  Digestive system
   04972 Pancreatic secretion
    64600 (PLA2G2F)
   04975 Fat digestion and absorption
    64600 (PLA2G2F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     64600 (PLA2G2F)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    64600 (PLA2G2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Motif
Other DBs
NCBI-GeneID: 64600
NCBI-ProteinID: NP_073730
OMIM: 616793
HGNC: 30040
Ensembl: ENSG00000158786
Vega: OTTHUMG00000002704
Pharos: Q9BZM2(Tchem)
UniProt: Q9BZM2
Position
1p36.12
AA seq 211 aa AA seqDB search
MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGMKKFFTVAILAGSVLST
AHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCCYQELFDQ
GCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVY
CQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcagatggggcaaaggccaaccccaaagggttcaaaaagaaggtgctggatagatgc
ttctctgggtggaggggcccacgcttcggggcctcctgtccttcaagaacctccaggtct
agcctgggtatgaagaagttcttcaccgtggccatccttgctggcagcgttctgtccaca
gctcacggcagcctgctcaacctgaaggccatggtggaggccgtcacagggaggagcgcc
atcctgtccttcgtgggctacggttgctactgtgggctggggggccgtggccagcccaag
gatgaggtggactggtgctgccacgcccacgactgctgctaccaggaactctttgaccaa
ggctgtcacccctatgtggaccactatgatcacaccatcgagaacaacactgagatagtc
tgcagtgacctcaacaagacagagtgtgacaagcagacatgcatgtgtgacaagaacatg
gttctgtgcctcatgaaccagacgtaccgagaggagtaccgtggcttcctcaatgtctac
tgccagggccccacgcccaactgcagcatctatgaaccgccccctgaggaggtcacctgc
agtcaccaatccccagcgccccccgcccctccctag

DBGET integrated database retrieval system