KEGG   Homo sapiens (human): 646000
Entry
646000            CDS       T01001                                 
Symbol
SLC35G4, AMAC1L1, SLC35G4P
Name
(RefSeq) solute carrier family 35 member G4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 646000
NCBI-ProteinID: NP_001269229
HGNC: 31043
Ensembl: ENSG00000236396
Pharos: P0C7Q5(Tdark)
UniProt: P0C7Q5
Position
18:11609596..11610612
AA seq 338 aa
MAGSHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGFVGPLSRM
AYQASNLPSLELVICRCLFHLPIALLLKLRGDPLLGPPDIRGRTCFCALLNVLNIGCAYS
AVQVVPTGNAATVRKHSSTVCSAILTLCLESQVLSGYDWCGLLGSILGLIIIVGPGLWTL
QEGTTGVYTGLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGSVPGLFV
LQSPVLPSDLLSWSCVGAVGILTLVSFTCVGYAVTKAHPALVCAVLHSEVVMALILQYFM
LHETVAPSDIMGAGVVLGSIAIITARNLICERTGKVEE
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctggcagtcacccctacttcaacctgcctgactccacacacccatcgccgccctcc
actccacccagcctccactggcaccagcgctgccagccctctgatgccaccaatggcctg
ctggtggccctgctgggtgggggcctgcctgctggcttcgtgggccccctttctcgtatg
gcttaccaggcttccaacctgccctcgctggagctggtcatctgtcgatgcctcttccac
ctccctattgccctgctacttaaactgcgtggcgacccccttctgggacctcctgacatc
cgaggccgcacctgcttctgtgccctgctcaacgtcctcaacattggatgtgcctatagt
gcggttcaggtggtgcccactggcaatgctgccactgttcgcaaacattcttccaccgtc
tgctccgccatcctcaccctctgccttgagagccaggttctcagtggctacgactggtgt
ggactgttgggcagcatcctaggactaataatcattgtgggacctggactctggacacta
caggaggggaccacgggtgtctacaccggcctgggctatgtgcaggctttcctgggagga
ctggcgctgtccctggggcttctcgtctatcgttctctgcactttccctcctgcctccca
acagtggccttcctatctggcttggtggggctgctgggctctgtgccaggcctctttgtg
ctgcagtcccccgtgttgcccagtgacctcctgagttggagttgtgtgggggcagtgggg
atcctcaccttggtctccttcacatgtgtgggctatgcggtcaccaaggcccaccctgcc
ctggtgtgtgctgtcctgcattccgaggtggtgatggcccttatactgcagtattttatg
ctccatgagactgtggcaccttctgacatcatgggggcaggggttgtgctgggcagcatt
gccatcattacagcccggaacctcatctgtgagaggacagggaaggtggaggagtga

DBGET integrated database retrieval system