KEGG   Homo sapiens (human): 646174Help
Entry
646174            CDS       T01001                                 

Gene name
C16orf90
Definition
(RefSeq) chromosome 16 open reading frame 90
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4644
Motif
Other DBs
NCBI-GeneID: 646174
NCBI-ProteinID: NP_001073993
HGNC: 34455
Ensembl: ENSG00000215131
Vega: OTTHUMG00000154627
Pharos: A8MZG2(Tdark)
UniProt: A8MZG2
Position
16p13.3
AA seq 182 aa AA seqDB search
MEALVCAFSELHIREDAVSQAQGRPGHPDAPPNIYEGGLGSPQPQCPSAQGSKPKNFRLR
HLRGLGLYLESHPPPTGQCESHWLGRLMAGGCLPQPEGTAWALDLPQGTLGPRNSLCSAL
LEARLPRDSLGSSASSSSMDPDKGALPQPSPSRLRPKRSWGTWEEAMCPLCKRTRSGALE
RP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttggtctgtgcattttctgagctgcacataagagaagatgcagtgagccag
gcccaaggacgccccggccaccctgacgcaccccccaacatctacgaggggggcctgggg
tccccgcagccgcagtgccccagtgcccagggaagcaagcccaagaacttccggctgcgc
cacctccggggcctgggcctctacctggagagccacccgccacccactggccagtgtgag
agccactggctgggccggcttatggctgggggctgcctgccacagcctgagggcacagcc
tgggccctggacctgccacaggggactctgggcccacgtaacagcctctgttcagccctt
ctggaagcccgattgcccagggacagcctgggaagcagtgcttccagttccagcatggac
ccagacaagggtgccctcccccagcctagtccttctaggctcaggcccaagaggtcctgg
gggacctgggaagaggccatgtgtcccttgtgcaagagaacccgctctggggccctggag
aggccatag

DBGET integrated database retrieval system