KEGG   Homo sapiens (human): 646627
Entry
646627            CDS       T01001                                 

Gene name
LYPD8
Definition
(RefSeq) LY6/PLAUR domain containing 8
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UPAR_LY6
Other DBs
NCBI-GeneID: 646627
NCBI-ProteinID: NP_001078943
OMIM: 617067
HGNC: 44208
Ensembl: ENSG00000259823
Vega: OTTHUMG00000174833
Pharos: Q6UX82(Tdark)
UniProt: Q6UX82
Position
1q44
AA seq 237 aa
MKGILVAGITAVLVAAVESLSCVQCNSWEKSCVNSIASECPSHANTSCISSSASSSLETP
VRLYQNMFCSAENCSEETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVS
SNAECPACYESNGTSCHGKPWKCYEEEQCVFLVAELKNDIESKSLVLKGCSNVSNATCQF
LSGENKTLGGVIFRKFECANVNSLTPTSAPTTSHNVGSKASLYLLALASLLLRGLLP
NT seq 714 nt   +upstreamnt  +downstreamnt
atgaagggcatcctcgttgctggtatcactgcagtgcttgttgcagctgtagaatctctg
agctgcgtgcagtgtaattcatgggaaaaatcctgtgtcaacagcattgcctctgaatgt
ccctcacatgccaacaccagctgtatcagctcctcagccagctcctctctagagacacca
gtcagattataccagaatatgttctgctcagcggagaactgcagtgaggagacacacatt
acagccttcactgtccacgtgtctgctgaagaacactttcattttgtaagccagtgctgc
caaggaaaggaatgcagcaacaccagcgatgccctggaccctcccctgaagaacgtgtcc
agcaacgcagagtgccctgcttgttatgaatctaatggaacttcctgtcatgggaagccc
tggaaatgctatgaagaagaacagtgtgtctttctagttgcagaacttaagaatgacatt
gagtctaagagtctcgtgctgaaaggctgttccaacgtcagtaacgccacctgtcagttc
ctgtctggtgaaaacaagactcttggaggagtcatctttcgaaagtttgagtgtgcaaat
gtaaacagcttaacccccacgtctgcaccaaccacttcccacaacgtgggctccaaagct
tccctctacctcttggcccttgccagcctccttcttcggggactgctgccctga

DBGET integrated database retrieval system