KEGG   Homo sapiens (human): 64682
Entry
64682             CDS       T01001                                 

Gene name
ANAPC1, APC1, MCPR, TSG24
Definition
(RefSeq) anaphase promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64682 (ANAPC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    64682 (ANAPC1)
   04114 Oocyte meiosis
    64682 (ANAPC1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    64682 (ANAPC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64682 (ANAPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    64682 (ANAPC1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    64682 (ANAPC1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     64682 (ANAPC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    64682 (ANAPC1)
SSDB
Motif
Pfam: APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 64682
NCBI-ProteinID: NP_073153
OMIM: 608473
HGNC: 19988
Ensembl: ENSG00000153107
Vega: OTTHUMG00000131277
Pharos: Q9H1A4(Tbio)
UniProt: Q9H1A4
Structure
PDB: 

Position
2q13
AA seq 1944 aa
MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANV
WPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSS
LTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNI
REKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKP
LSKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELS
NGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLF
VTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMG
EGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRIT
IAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMN
HEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS
APNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISA
FTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRL
GRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWL
QVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgtcgaacttctatgaagaaaggacaacgatgattgcagcaagggatttgcaggaattt
gttccttttggtcgagaccactgcaagcaccaccctaatgctttgaaccttcaacttcgc
cagctgcagccagcttctgaattatggtcttctgatggtgctgctggcttggtgggatcc
cttcaggaggttacaatccacgagaaacagaaggaaagctggcagttaaggaaaggagta
agtgaaattggagaagatgtggactatgatgaggaactctatgttgctggaaatatggtg
atatggagcaaaggaagtaaaagccaggcattggcagtttataaagcatttacagttgac
agtcctgttcagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
gcctacagtagcaatgaagtagaaaaatgcatatgtatattgcaaagctcatgtattaac
atgcatagcatagaaggaaaggattacatagcttcattaccatttcaggttgcaaatgtt
tggcccactaaatatggattgctgtttgaacgaagcgcttcttcacatgaagtacctcca
ggttcacccagagaacctttacctactatgttcagcatgctgcacccactagatgaaata
actccacttgtttgtaaatctggaagtctttttggttcatcacgggtgcaatatgttgta
gatcatgcaatgaaaattgttttcctcaatactgacccctctattgtaatgacttatgat
gctgttcaaaatgtgcattctgtgtggactctccggagagtcaaatcagaggaagagaat
gttgttttaaagttctctgaacaggggggaaccccacagaatgtggccactagcagctcc
ctcacagcacatctcagaagcctctccaaaggagattcccctgtgacttcacctttccag
aattactcctccattcacagccagagtcgctcaacctcatcacccagtctacattctcgc
tcaccttctatttccaacatggcagctctaagtcgtgctcattctcctgcgttaggagtg
cactctttttcaggggtgcaaaggttcaacatttcaagccataatcagtctccaaagaga
catagtatttctcattctccaaatagtaattctaatggctcctttcttgcaccagaaacg
gagccaattgttcctgaactgtgtattgaccatttgtggacagaaacgattactaatata
agagagaaaaattcacaagcctcaaaagtgtttattacatctgacctatgtgggcaaaag
ttcctgtgctttttagtagagtcccagctccagttacgctgtgtaaagtttcaagagagt
aatgataaaacccagctcatctttggttcagtgaccaacataccagcaaaggatgcagca
ccagtggagaaaatagacaccatgctggtcttggaaggcagtggaaacctggtgctatac
acaggagtggttcgggtgggaaaggtttttattcctggactgccagctccctctctgacg
atgtccaacacaatgcctcggcccagtactccactagatggcgttagtactccaaagcct
cttagtaaactccttggatcattggacgaggttgttctgttgtccccagttccagaactg
agggattcttcaaaacttcatgattctctctataatgaggattgtactttccaacagctt
ggaacttacattcattctatcagagatcctgtccataacagagtcaccctggaactgagt
aatggctccatggttaggatcactattcctgaaattgccacctctgagttagtacaaacg
tgtttgcaagcaattaagtttatcctgccaaaagaaatagcagttcagatgcttgtcaag
tggtacaatgtccacagtgctccaggaggacccagttatcactcagagtggaatttattt
gtgacttgtctcatgaacatgatgggttataacacagaccgcttagcatggactagaaat
tttgactttgaaggatcactttctcctgtcattgcgcccaaaaaagcaaggccttccgag
actggatctgatgatgactgggaatatttactaaattcagactaccaccagaatgttgag
tctcatcttttgaacagatctttatgtctgagtccttcagaagcttcacagatgaaggat
gaggatttttcacagaatctcagtctggattcttctacacttctctttactcacatacct
gcaatttttttcgttcttcaccttgtgtatgaggagcttaagttgaatactctaatggga
gaaggaatttgttcacttgttgaacttctcgttcagttggcaagggacttaaaattgggg
ccttatgtagatcattactatagagactacccaacgcttgtcagaactactggacaagtg
tgcacaattgatccaggtcaaacaggatttatgcatcatccatcattttttacgtctgag
ccaccaagtatttatcagtgggtgagttcttgtctgaagggtgaaggaatgccaccttat
ccttacctccctggaatctgtgaaagaagcagacttgtagtcttgagtattgcactgtac
atacttggtgatgagagcttggtttctgatgaatcctcacagtatttaaccagaataact
atagccccccagaagttgcaagtagaacaagaggaaaacaggtttagtttcaggcattct
acatctgtttctagtctagctgaaagattggttgtctggatgactaatgtaggattcact
ttaagagatttggaaactcttccctttggaattgctcttcccatcagagatgcaatttat
cactgtcgtgagcagcctgcctcagactggccagaagctgtctgtctcttgattggacgt
caggatctttccaagcaggcctgcgaaggaaacttacccaaagggaagtctgtgctctca
tcagatgttccttcaggaacagaaactgaggaggaagatgacggcatgaatgacatgaat
cacgaggtcatgtcattaatatggagtgaagatttaagggtgcaggatgtgcgaaggctt
cttcagagtgcgcatcctgtccgtgtcaacgtagtgcagtacccagagctcagtgaccac
gagttcatcgaggaaaaggaaaacagattgctccaattgtgtcagcgaactatggctctt
cctgtaggacgaggaatgtttaccttgttttcgtaccatcctgttccaacagagccattg
cctattcctaaattgaatctgactgggcgtgcccctcctcggaacacaacagtagacctt
aatagtggaaacatcgatgtgcctcccaacatgacaagctgggccagctttcataatggt
gtggctgctggcctgaagatagctcctgcctcccagatcgactcagcttggattgtttac
aataagcccaagcatgctgagttggccaatgagtatgctggctttctcatggctctgggt
ttgaatgggcaccttaccaagctggcgactctcaatatccatgactacttgaccaagggc
catgaaatgacaagcattggactgctacttggtgtttctgctgcaaaactaggcaccatg
gatatgtctattactcggcttcttagcattcacattcctgctctcttacccccaacgtcc
acagagctggatgttcctcacaatgtccaagtggctgcagtggttggcattggccttgta
tatcaagggacagctcacagacatactgcagaagtcctgttggctgagataggacggcct
cctggtcctgaaatggaatactgcactgacagagagtcatactccttagctgctggcttg
gccctgggcatggtctgcttggggcatggcagcaatttgataggtatgtctgatctcaat
gtgcctgagcagctctatcagtacatggttggaggacataggcgctttcaaacaggaatg
catagggagaaacataaatcaccaagttatcaaatcaaagaaggagataccataaatgtg
gatgtgacttgtccaggtgctactctagctttggctatgatctacttaaaaaccaataac
agatctattgcagattggctccgagcccctgacaccatgtatttgttggactttgtgaag
ccagaatttctcttgcttaggacacttgctcgatgcctgattttgtgggatgatatttta
ccaaattccaagtgggttgacagcaatgttcctcaaattataagagaaaatagtatctct
ctcagtgaaatcgaattgccgtgctcagaggatttgaatttggaaactttgtcccaagca
catgtctacataattgcaggagcctgcttgtctctgggttttcgatttgctggctcagaa
aacttatcagcatttaactgtttgcataaatttgccaaagattttatgacttatttgtcc
gcacctaatgcttctgttacaggtcctcataacctagaaacttgtctgagcgtggtgctg
ctgtctctcgccatggtcatggctggctcaggaaacctaaaggttttgcagctttgtcgc
ttcttacacatgaaaacgggtggtgaaatgaactatggttttcacttagcccaccacatg
gcccttggacttctatttttgggaggaggaaggtactctttgagcacatcaaattcttcc
attgccgctcttctctgtgccctttatccgcacttcccagctcacagcactgacaaccgg
tatcatctccaggctctccggcacctctatgtgctggccgcggagcccaggcttctagtg
cctgtggatgtggacacaaacacgccctgctatgccctcttagaagttacctacaagggc
actcagtggtatgaacaaaccaaagaagaattgatggctcctacccttcttccagaactc
catcttttaaagcagattaaagtaaaaggcccaagatactgggaactgctcatagattta
agcaaaggaacacaacacttgaagtccatcctttccaaggatggggttttatatgttaaa
ctccgggcgggtcagctctcctacaaagaagatccaatgggatggcaaagtttgttggct
cagactgttgctaacaggaactctgaagcccgggctttcaagccagaaacaatctcagca
ttcacttctgatccagcacttctgtcatttgctgaatatttctgcaagccaactgtgaac
atgggtcagaaacaggaaattctggatctcttttcttcagtactctatgaatgtgttacc
caggagaccccagagatgttgcctgcatacatcgcaatggatcaggctataagaagactt
gggagaagagaaatgtctgagacttctgaactttggcagataaagttggtgttagagttt
ttcagctcccgaagccatcaggagcggctgcagaaccaccctaagcgggggctctttatg
aactcggaattcctccctgttgtgaagtgcaccattgataataccctggaccagtggcta
caagtcgggggtgatatgtgtgtgcacgcctacctcagcgggcagcccttggaggaatca
cagctgagcatgctggcctgcttcctcgtctaccactctgtgccagctccacagcacctg
ccacctataggactagaagggagcacaagctttgctgaactgctcttcaaatttaagcag
ctaaaaatgccagtgcgagctttgctgagattggctcctttgcttcttggaaatccacag
ccaatggtgatgtga

DBGET integrated database retrieval system