KEGG   Homo sapiens (human): 6469Help
Entry
6469              CDS       T01001                                 

Gene name
SHH, HHG1, HLP3, HPE3, MCOPCB5, SMMCI, ShhNC, TPT, TPTPS
Definition
(RefSeq) sonic hedgehog signaling molecule
  KO
K11988  sonic hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05226  Gastric cancer
Module
hsa_M00678  Hedgehog signaling
Network
nt06217  HH signaling
nt06240  Transcription
nt06261  Gastric cancer
nt06269  Basal cell carcinoma
  Element
N00062  Hedgehog signaling pathway
N00251  CDX2-overexpression to transcriptional repression
Disease
H00039  Basal cell carcinoma
H00267  Holoprosencephaly
H00652  Solitary median maxillary central incisor syndrome
H01027  Microphthalmia
H01160  Schizencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    6469 (SHH)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    6469 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6469 (SHH)
   05205 Proteoglycans in cancer
    6469 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    6469 (SHH)
   05217 Basal cell carcinoma
    6469 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    6469 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6469 (SHH)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C46: hedgehog family
   6469 (SHH)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   6469 (SHH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Motif
Other DBs
NCBI-GeneID: 6469
NCBI-ProteinID: NP_000184
OMIM: 600725
HGNC: 10848
Ensembl: ENSG00000164690
Vega: OTTHUMG00000151349
Pharos: Q15465(Tchem)
UniProt: Q15465
Structure
PDB: 

Position
7q36.3
AA seq 462 aa AA seqDB search
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggcgagatgtctgctgctagtcctcgtctcctcgctgctggtatgctcg
ggactggcgtgcggaccgggcagggggttcgggaagaggaggcaccccaaaaagctgacc
cctttagcctacaagcagtttatccccaatgtggccgagaagaccctaggcgccagcgga
aggtatgaagggaagatctccagaaactccgagcgatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaagaaaacaccggagcggacaggctgatgactcag
aggtgtaaggacaagttgaacgctttggccatctcggtgatgaaccagtggccaggagtg
aaactgcgggtgaccgagggctgggacgaagatggccaccactcagaggagtctctgcac
tacgagggccgcgcagtggacatcaccacgtctgaccgcgaccgcagcaagtacggcatg
ctggcccgcctggcggtggaggccggcttcgactgggtgtactacgagtccaaggcacat
atccactgctcggtgaaagcagagaactcggtggcggccaaatcgggaggctgcttcccg
ggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggacctgagcccc
ggggaccgcgtgctggcggcggacgaccagggccggctgctctacagcgacttcctcact
ttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacgcgggagccg
cgcgagcgcctgctgctcaccgccgcgcacctgctctttgtggcgccgcacaacgactcg
gccaccggggagcccgaggcgtcctcgggctcggggccgccttccgggggcgcactgggg
cctcgggcgctgttcgccagccgcgtgcgcccgggccagcgcgtgtacgtggtggccgag
cgtgacggggaccgccggctcctgcccgccgctgtgcacagcgtgaccctaagcgaggag
gccgcgggcgcctacgcgccgctcacggcccagggcaccattctcatcaaccgggtgctg
gcctcgtgctacgcggtcatcgaggagcacagctgggcgcaccgggccttcgcgcccttc
cgcctggcgcacgcgctcctggctgcactggcgcccgcgcgcacggaccgcggcggggac
agcggcggcggggaccgcgggggcggcggcggcagagtagccctaaccgctccaggtgct
gccgacgctccgggtgcgggggccaccgcgggcatccactggtactcgcagctgctctac
caaataggcacctggctcctggacagcgaggccctgcacccgctgggcatggcggtcaag
tccagctga

DBGET integrated database retrieval system