KEGG   Homo sapiens (human): 6472Help
Entry
6472              CDS       T01001                                 

Gene name
SHMT2, GLYA, HEL-S-51e, SHMT
Definition
(RefSeq) serine hydroxymethyltransferase 2
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa00670  One carbon pool by folate
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa01523  Antifolate resistance
Module
hsa_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    6472 (SHMT2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    6472 (SHMT2)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    6472 (SHMT2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    6472 (SHMT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     6472 (SHMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SHMT
Motif
Other DBs
NCBI-GeneID: 6472
NCBI-ProteinID: NP_005403
OMIM: 138450
HGNC: 10852
Ensembl: ENSG00000182199
Vega: OTTHUMG00000171246
Pharos: P34897(Tbio)
UniProt: P34897 V9HW06 Q5BJF5
Structure
PDB: 

Position
12q13.3
AA seq 504 aa AA seqDB search
MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELL
QREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDV
KRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREV
CDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVD
PKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARA
MADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT
PGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQ
RLANLRQRVEQFARAFPMPGFDEH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacttctctttgttttgggcggctcggcctctgcagagatgtgggcagctggtc
aggatggccattcgggctcagcacagcaacgcagcccagactcagactggggaagcaaac
aggggctggacaggccaggagagcctgtcggacagtgatcctgagatgtgggagttgctg
cagagggagaaggacaggcagtgtcgtggcctggagctcattgcctcagagaacttctgc
agccgagctgcgctggaggccctggggtcctgtctgaacaacaagtactcggagggttat
cctggcaagagatactatgggggagcagaggtggtggatgaaattgagctgctgtgccag
cgccgggccttggaagcctttgacctggatcctgcacagtggggagtcaatgtccagccc
tactccgggtccccagccaacctggccgtctacacagcccttctgcaacctcacgaccgg
atcatggggctggacctgcccgatgggggccatctcacccacggctacatgtctgacgtc
aagcggatatcagccacgtccatcttcttcgagtctatgccctataagctcaaccccaaa
actggcctcattgactacaaccagctggcactgactgctcgacttttccggccacggctc
atcatagctggcaccagcgcctatgctcgcctcattgactacgcccgcatgagagaggtg
tgtgatgaagtcaaagcacacctgctggcagacatggcccacatcagtggcctggtggct
gccaaggtgattccctcgcctttcaagcacgcggacatcgtcaccaccactactcacaag
actcttcgaggggccaggtcagggctcatcttctaccggaaaggggtgaaggctgtggac
cccaagactggccgggagatcccttacacatttgaggaccgaatcaactttgccgtgttc
ccatccctgcaggggggcccccacaatcatgccattgctgcagtagctgtggccctaaag
caggcctgcacccccatgttccgggagtactccctgcaggttctgaagaatgctcgggcc
atggcagatgccctgctagagcgaggctactcactggtatcaggtggtactgacaaccac
ctggtgctggtggacctgcggcccaagggcctggatggagctcgggctgagcgggtgcta
gagcttgtatccatcactgccaacaagaacacctgtcctggagaccgaagtgccatcaca
ccgggcggcctgcggcttggggccccagccttaacttctcgacagttccgtgaggatgac
ttccggagagttgtggactttatagatgaaggggtcaacattggcttagaggtgaagagc
aagactgccaagctccaggatttcaaatccttcctgcttaaggactcagaaacaagtcag
cgtctggccaacctcaggcaacgggtggagcagtttgccagggccttccccatgcctggt
tttgatgagcattga

DBGET integrated database retrieval system