KEGG   Homo sapiens (human): 64745Help
Entry
64745             CDS       T01001                                 

Gene name
METTL17, METT11D1
Definition
(RefSeq) methyltransferase like 17
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Rsm22 Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 64745
NCBI-ProteinID: NP_073571
OMIM: 616091
HGNC: 19280
Ensembl: ENSG00000165792
Vega: OTTHUMG00000029610
Pharos: Q9H7H0(Tdark)
UniProt: Q9H7H0 A0A0S2Z5L8
Position
14q11.2
AA seq 456 aa AA seqDB search
MAAALKCLLTLGRWCPGLGVAPQARALAALVPGVTQVDNKSGFLQKRPHRQHPGILKLPH
VRLPQALANGAQLLLLGSAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLEN
PDLSQTEEKLRGAVLHALRKTTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRAR
NPAFQPQTLMDFGSGTGSVTWAAHSIWGQSLREYMCVDRSAAMLVLAEKLLKGGSESGEP
YIPGVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLVLVENGTK
AGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSW
NKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRH
GRDLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcactgaagtgtctactgacattaggaagatggtgccccggccttggagtg
gctccccaggcccgggcgctcgccgccttagtacccggagtgacccaggtagataacaag
tccggtttcctgcagaagaggcctcatcgccagcaccctggcatcctaaagctgccgcac
gtgcggctgccacaggcactggctaacggtgcccagttattgctacttgggagcgctggg
cccactatggagaatcaggtgcaaacactgaccagttatctctggagcagacatttgcct
gtagagccagaggagttgcaaagacgggctaggcatcttgagaaaaaattcctggaaaac
ccagacttatctcagacagaggagaaacttcgtggagcagtgctacacgcactacgtaaa
actacctaccattggcaagaactgagctacactgagggactgagcctggtgtatatggca
gcaagactggatggtggctttgcagcagtctccagagcattccatgagatccgggctcga
aatccagcatttcagccacaaactttgatggactttggctcaggtactggttctgtcacc
tgggctgctcacagtatttggggccagagcctacgtgaatatatgtgtgtggacagatca
gctgccatgttggttttggcagaaaaactactgaaaggtggttcagaatctggggagcct
tatattccaggtgtctttttcagacagtttctacctgtatcacccaaggtgcagtttgat
gtagtagtgtcagctttttccttaagtgaactgcccagcaaggctgaccgcactgaggta
gttcaaaccttatggcgtaagacaggtcatttcctggtactggtggagaatggaacaaaa
gctgggcacagccttctcatggatgccagggatctggtccttaagggaaaagagaagtca
cctttggaccctcgacctggttttgtctttgccccgtgtccccatgaactcccttgtccc
cagttgaccaacctggcctgtagcttctcacaggcgtaccatcccatccccttcagctgg
aacaagaaaccaaaggaagaaaagttctctatggtgatccttgctcgggggtctccagag
gaggctcatcgctggccccgtatcactcagcctgtccttaaacggcctcgccatgtgcat
tgtcacttgtgctgtccagatgggcacatgcagcatgctgtgctcacagcccgccggcac
ggcagggatttgtatcgttgtgcccgtgtcagctcctggggagatcttttacctgtgctt
actccgtctgcgtttcctccatctacggctcaggatccctctgagagttga

DBGET integrated database retrieval system