KEGG   Homo sapiens (human): 64746
Entry
64746             CDS       T01001                                 

Gene name
ACBD3, GCP60, GOCAP1, GOLPH1, PAP7
Definition
(RefSeq) acyl-CoA binding domain containing 3
  KO
K23935  golgi resident protein GCP60
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    64746 (ACBD3)
SSDB
Motif
Pfam: GOLD_2 ACBP
Other DBs
NCBI-GeneID: 64746
NCBI-ProteinID: NP_073572
OMIM: 606809
HGNC: 15453
Ensembl: ENSG00000182827
Vega: OTTHUMG00000037560
Pharos: Q9H3P7(Tbio)
UniProt: Q9H3P7 A0A024R3P9
Structure
PDB: 

Position
1q42.12
AA seq 528 aa
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEP
GEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL
MGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHK
IEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLE
QQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQ
QAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALEN
GPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIV
PVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggcggcggtgctgaacgcagagcgactcgaggtgtccgtcgacggcctcacgctcagc
ccggacccggaggagcggcctggggcggagggcgccccgctgctgccgccaccgctgcca
ccgccctcgccacctggatccggtcgcggcccgggcgcctcaggggagcagcccgagccc
ggggaggcggcggctgggggcgcggcggaggaggcgcggcggctggagcagcgctggggt
ttcggcctggaggagttgtacggcctggcactgcgcttcttcaaagaaaaagatggcaaa
gcatttcatccaacttatgaagaaaaattgaagcttgtggcactgcataagcaagttctt
atgggcccatataatccagacacttgtcctgaggttggattctttgatgtgttggggaat
gacaggaggagagaatgggcagccctgggaaacatgtctaaagaggatgccatggtggag
tttgtcaagctcttaaataggtgttgccatctcttttcaacatatgttgcgtcccacaaa
atagagaaggaagagcaagaaaaaaaaaggaaggaggaagaggagcgaaggcggcgtgaa
gaggaagaaagagaacgtctgcaaaaggaggaagagaaacgtaggagagaagaagaggaa
aggcttcgacgggaggaagaggaaaggagacggatagaagaagaaaggcttcggttggag
cagcaaaagcagcagataatggcagctttaaactcccagactgccgtgcagttccagcag
tatgcagcccaacagtatccagggaactacgaacagcagcaaattctcatccgccagttg
caggagcaacactatcagcagtacatgcagcagttgtatcaagtccagcttgcacagcaa
caggcagcattacagaaacaacaggaagtagtagtggctgggtcttccttgcctacatca
tcaaaagtgaatgcaactgtaccaagtaatatgatgtcagttaatggacaggccaaaaca
cacactgacagctccgaaaaagaactggaaccagaagctgcagaagaagccctggagaat
ggaccaaaagaatctcttccagtaatagcagctccatccatgtggacacgacctcagatc
aaagacttcaaagagaagattcagcaggatgcagattccgtgattacagtgggccgagga
gaagtggtcactgttcgagtacccacccatgaagaaggatcatatctcttttgggaattt
gccacagacaattatgacattgggtttggggtgtattttgaatggacagactctccaaac
actgctgtcagcgtgcatgtcagtgagtccagcgatgacgacgaggaggaagaagaaaac
atcggttgtgaagagaaagccaaaaagaatgccaacaagcctttgctggatgagattgtg
cctgtgtaccgacgggactgtcatgaggaggtgtatgctggcagccatcaatatccaggg
agaggagtctatctcctcaagtttgacaactcctactctttgtggcggtcaaaatcagtc
tactacagagtctattatactagataa

DBGET integrated database retrieval system