KEGG   Homo sapiens (human): 64748
Entry
64748             CDS       T01001                                 

Gene name
PLPPR2, LPPR2, PRG4
Definition
(RefSeq) phospholipid phosphatase related 2
  KO
K19581  lipid phosphate phosphatase-related protein type 1/2/5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    64748 (PLPPR2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 64748
NCBI-ProteinID: NP_073574
HGNC: 29566
Ensembl: ENSG00000105520
Vega: OTTHUMG00000182023
Pharos: Q96GM1(Tdark)
UniProt: Q96GM1 A0A024R7E2
Position
19p13.2
AA seq 343 aa
MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSTYAKPY
PGPEAASRVPPALVYALVTAGPTLTILLGELARAFFPAPPSAVPVIGESTIVSGACCRFS
PPVRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCLPPSPDRPG
PDRFVTDQGACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL
CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPPSGRRLSP
WEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcgggagggagaccgcatctgaagaggagtttctccatcatcccctgctttgtcttc
gtggagtcggtgctgctgggcattgtgatcctgcttgcttaccgcctggagttcacggac
accttccctgtgcacacccagggattcttctgctatgacagtacctacgccaagccctac
ccagggcctgaggctgccagccgagtgcctcctgctcttgtctacgcactggtcactgcc
gggcccaccctcacgatcctgctgggagagctggcgcgtgcctttttccctgcaccacct
tcagccgtcccagtcatcggggagagcaccatcgtgtctggggcctgctgccgcttcagc
cccccagtgcggaggctggtccgcttcctgggggtctactccttcggcctcttcaccacg
accatcttcgccaacgcggggcaggtggtgaccggcaatcccacgccacacttcctgtcc
gtgtgccgccccaactacacggccctgggctgcctgccaccttctccggatcggccaggt
cccgaccgctttgtcactgaccagggtgcctgcgctggcagtcccagcctcgtggccgcc
gcgcgccgcgccttcccctgcaaggatgcggccctctgcgcctacgcggtcacctacaca
gcgatgtacgtgactctcgtgttccgcgtgaagggctcccgcctggtcaaaccctcgctc
tgcctggccttgctgtgcccggccttcctggtgggcgtggtccgcgtggccgagtaccga
aaccactggtcggacgtgctggctggcttcctgacaggggcggccatcgccacctttttg
gtcacctgcgttgtgcataactttcagagccggccaccctctggccgaaggctctctccc
tgggaggacctgggccaagcccccaccatggatagccccctcgaaaagaacccgaggtct
gcaggccgcattcgacaccggcacggctcaccccatccaagtcgcagaactgcgcccgcc
gtggccacctga

DBGET integrated database retrieval system